Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacsu-cbxnp

Bacillus subtilis carboxylesterase NA ou NP naproxen ester hydrolase CesA P96688

Comment
only few diff from previous Bacillus subtilis ThaiI-8 pirI40425 carboxylesterase naproxen (U17574)(X82892) Trembl Q59248 CesA BsE-NP01


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Bacillus subtilis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
>3 Genbank links 1 more: Z99106, AB001488, U17574
1 Ncbi-nid : 2632653
1 Ncbi-pid : 2632844
2 Structure : 4CCW, 2R11
2 UniProt : P96688, Q59248
2 Interpro : P96688, Q59248
2 Prodom : P96688, Q59248
2 Pfam : P96688, Q59248
2 PIRSF : P96688, Q59248
2 SUPERFAM : P96688, Q59248
Sequence
Graphical view for this peptide sequence: bacsu-cbxnp
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MSNHSSSIPELSDNGIRYYQTYNESLSLWPVRCKSFYISTRFGQTHVIAS
GPEDAPPLVLLHGALFSSTMWYPNIADWSSKYRTYAVDIIGDKNKSIPEN
VSGTRTDYANWLLDVFDNLGIEKSHMIGLSLGGLHTMNFLLRMPERVKSA
AILSPAETFLPFHHDFYKYALGLTASNGVETFLNWMMNDQNVLHPIFVKQ
FKAGVMWQDGSRNPNPNADGFPYVFTDEELRSARVPILLLLGEHEVIYDP
HSALHRASSFVPDIEAEVIKNAGHVLSMEQPTYVNERVMRFFNAETGISR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSNHSSSIPELSDNGIRYYQTYNESLSLWPVRCKSFYISTRFGQTHVIAS
GPEDAPPLVLLHGALFSSTMWYPNIADWSSKYRTYAVDIIGDKNKSIPEN
VSGTRTDYANWLLDVFDNLGIEKSHMIGLSLGGLHTMNFLLRMPERVKSA
AILSPAETFLPFHHDFYKYALGLTASNGVETFLNWMMNDQNVLHPIFVKQ
FKAGVMWQDGSRNPNPNADGFPYVFTDEELRSARVPILLLLGEHEVIYDP
HSALHRASSFVPDIEAEVIKNAGHVLSMEQPTYVNERVMRFFNAETGISR


References
6 more
    Title: Identification of lipases with activity towards monoacylglycerol by criterion of conserved cap architectures
    Riegler-Berket L, Leitmeier A, Aschauer P, Dreveny I, Oberer M
    Ref: Biochimica & Biophysica Acta, 1863:679, 2018 : PubMed

            

    Title: Crystal structures of two Bacillus carboxylesterases with different enantioselectivities
    Rozeboom HJ, Godinho LF, Nardini M, Quax WJ, Dijkstra BW
    Ref: Biochimica & Biophysica Acta, 1844:567, 2014 : PubMed

            

    Title: Comparison and functional characterisation of three homologous intracellular carboxylesterases of Bacillus subtilis
    Droge MJ, Bos R, Boersma YL, Quax WJ
    Ref: J Mol Catal B Enzym, 32:261, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer