Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacsu-q6yk39

Bacillus subtilis Bacillus amyloliquefaciens; Bacillus velezensis; Mycobacterium abscessus; Bacillus sp., bacillomycin d synthetase c

Comment
Other strains: Bacillus subtilis; Bacillus amyloliquefaciens; Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42) (amyloliquefaciens subsp.); Mycobacterium abscessus subsp.; Bacillus sp.


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Bacillus subtilis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: bacsu-q6yk39
Colored MSA for Thioesterase (raw)
DDSLNTAQLKRHLLNKLPAYMIPAYFVQMEKMPITANGKIERKALPAPEG
NRLTGTEYEAPGTLIEKQLAEIWKNILALSDPGIKDNFFDVGGHSLKVLQ
VIHQINDRMGIKMHYQAVYDFPTIETMARAIQAAVFESKTDNVFVKMNQN
GSIPVFCFPPLIGYGLVYNEMAKRLAGRCTVYAADFLEEPSYEQEIVDRY
AESMIGIQEQGPFVLLGYSSGSNLAFEVAKALEKRGRIVSDIMMLDSKRA
VSVNYFSEKETEEIIHRNLDIIPDYYRELLTIPSIKDKIRSYLTYHNKLI
NSGAVNANIHHFLCGELTDRGWKQSTAQHYFEYKLKGDHVTIFDPHNIEE
NTDTIRSIIKRIEERHHHGLVLEEQLSMGSFAGDAKFDKM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

DDSLNTAQLKRHLLNKLPAYMIPAYFVQMEKMPITANGKIERKALPAPEG
NRLTGTEYEAPGTLIEKQLAEIWKNILALSDPGIKDNFFDVGGHSLKVLQ
VIHQINDRMGIKMHYQAVYDFPTIETMARAIQAAVFESKTDNVFVKMNQN
GSIPVFCFPPLIGYGLVYNEMAKRLAGRCTVYAADFLEEPSYEQEIVDRY
AESMIGIQEQGPFVLLGYSSGSNLAFEVAKALEKRGRIVSDIMMLDSKRA
VSVNYFSEKETEEIIHRNLDIIPDYYRELLTIPSIKDKIRSYLTYHNKLI
NSGAVNANIHHFLCGELTDRGWKQSTAQHYFEYKLKGDHVTIFDPHNIEE
NTDTIRSIIKRIEERHHHGLVLEEQLSMGSFAGDAKFDKM


References
    Title: Structural and functional characterization of gene clusters directing nonribosomal synthesis of bioactive cyclic lipopeptides in Bacillus amyloliquefaciens strain FZB42
    Koumoutsi A, Chen XH, Henne A, Liesegang H, Hitzeroth G, Franke P, Vater J, Borriss R
    Ref: Journal of Bacteriology, 186:1084, 2004 : PubMed

            

    Title: Molecular characterization and analysis of the operon encoding the antifungal lipopeptide bacillomycin D
    Moyne AL, Cleveland TE, Tuzun S
    Ref: FEMS Microbiology Letters, 234:43, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer