bacsu-srf4

 
Bacillus subtilis csi16 Thioesterase domain

Relationship
Block X
Bacillus subtilis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 2K2Q, 2RON
No kinetic



3 Genbank : X70356, D50453, Z99105
1 UniProt : Q08788
2 Structure : 2K2Q, 2RON
1 UniProtTrembl : Q08788
1 Interpro : Q08788
1 Prodom : Q08788
1 Pfam : Q08788
1 PIRSF : Q08788
1 SUPERFAM : Q08788
1 QuickSwissBlast : Q08788
 
Sequence
Graphical view for this peptide sequence: bacsu-srf4
Colored MSA for Thioesterase (raw)
SQLFKSFDASEKTQLICFPFAGGYSASFRPLHAFLQGECEMLAAEPPGHG
TNQTSAIEDLEELTDLYKQELNLRPDRPFVLFGHSMGGMITFRLAQKLER
EGIFPQAVIISAIQPPHIQRKKVSHLPDDQFLDHIIQLGGMPAELVENKE
VMSFFLPSFRSDYRALEQFELYDLAQIQSPVHVFNGLDDKKCIRDAEGWK
KWAKDITFHQFDGGHMFLLSQTEEVAERIFAILNQHPIIQP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

SQLFKSFDASEKTQLICFPFAGGYSASFRPLHAFLQGECEMLAAEPPGHG
TNQTSAIEDLEELTDLYKQELNLRPDRPFVLFGHSMGGMITFRLAQKLER
EGIFPQAVIISAIQPPHIQRKKVSHLPDDQFLDHIIQLGGMPAELVENKE
VMSFFLPSFRSDYRALEQFELYDLAQIQSPVHVFNGLDDKKCIRDAEGWK
KWAKDITFHQFDGGHMFLLSQTEEVAERIFAILNQHPIIQP

no DNA




References
1 more
    Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
    Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)>
    Ref: Nature, 390:249, 1997 : PubMed

            

    Title: The 25 degrees-36 degrees region of the Bacillus subtilis chromosome: determination of the sequence of a 146 kb segment and identification of 113 genes
    Yamane K, Kumano M, Kurita K
    Ref: Microbiology, 142 ( Pt 11):3047, 1996 : PubMed

            

    Title: Sequence and analysis of the genetic locus responsible for surfactin synthesis in Bacillus subtilis
    Cosmina P, Rodriguez F, de Ferra F, Grandi G, Perego M, Venema G, van Sinderen D
    Ref: Molecular Microbiology, 8:821, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer