bacsu-ybfk

 
Bacillus subtilis ybkf CesB

Relationship
Block X
Bacillus subtilis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
4CCY: Crystal structure of carboxylesterase CesB (YbfK) from Bacillus subtilis
No kinetic

Substrate: IPG-caprylate , IPG-butyrate , IPG-acetate ,

2 Genbank : Z99105, AB006424
1 Ncbi-nid : 2632457
1 Ncbi-pid : 2632512
1 Structure : 4CCY
1 UniProtTrembl : O31452
1 Interpro : O31452
1 Prodom : O31452
1 Pfam : O31452
1 PIRSF : O31452
1 SUPERFAM : O31452
1 QuickSwissBlast : O31452
 
Sequence
Graphical view for this peptide sequence: bacsu-ybfk
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MIQDSMQFAAVESGLRFYQAYDQSLSLWPIESEAFYVSTRFGKTHIIASG
PKDAPSLILLHGGLFSSAMWYPNIAAWSSQFRTYAVDIIGDKNKSIPSAA
METRADFAEWMKDVFDSLGLETAHLAGLSLGGSHIVNFLLRAPERVERAV
VISPAEAFISFHPDVYKYAAELTGARGAESYIKWITGDSYDLHPLLQRQI
VAGVEWQDEQRSLKPTENGFPYVFTDQELKSIQVPVLLMFGEHEAMYHQQ
MAFERASVLVPGIQAEIVKNAGHLLSLEQPEYVNQRVLSFLCGGIK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIQDSMQFAAVESGLRFYQAYDQSLSLWPIESEAFYVSTRFGKTHIIASG
PKDAPSLILLHGGLFSSAMWYPNIAAWSSQFRTYAVDIIGDKNKSIPSAA
METRADFAEWMKDVFDSLGLETAHLAGLSLGGSHIVNFLLRAPERVERAV
VISPAEAFISFHPDVYKYAAELTGARGAESYIKWITGDSYDLHPLLQRQI
VAGVEWQDEQRSLKPTENGFPYVFTDQELKSIQVPVLLMFGEHEAMYHQQ
MAFERASVLVPGIQAEIVKNAGHLLSLEQPEYVNQRVLSFLCGGIK

Graphical view for this nucleotide DNA sequence (921 bp): bacsu-ybfk



References
    Title: Crystal structures of two Bacillus carboxylesterases with different enantioselectivities
    Rozeboom HJ, Godinho LF, Nardini M, Quax WJ, Dijkstra BW
    Ref: Biochimica & Biophysica Acta, 1844:567, 2014 : PubMed

            

    Title: Comparison and functional characterisation of three homologous intracellular carboxylesterases of Bacillus subtilis
    Droge MJ, Bos R, Boersma YL, Quax WJ
    Ref: J Mol Catal B Enzym, 32:261, 2005 : PubMed

            

    Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
    Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)>
    Ref: Nature, 390:249, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer