Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacsu-yclE

Bacillus subtilis yclE BAA08999.1

Relationship
Family|AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Bacillus subtilis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : D50453
1 Ncbi-nid : 1805369
1 Ncbi-pid : 1805437
1 UniProt : P94407
1 Interpro : P94407
1 Prodom : P94407
1 Pfam : P94407
1 PIRSF : P94407
1 SUPERFAM : P94407
Sequence
Graphical view for this peptide sequence: bacsu-yclE
Colored MSA for AlphaBeta_hydrolase (raw)
MERAGICHSDGFDLAYRIEGEGAPILVIGSAAYYPRLFSSDIKQKYQWVF
VDHRGFAKPKRELRAEDSRLDAVLADIERMRTFLQLEDVTTLGHSGHAFM
ALEYARTYPKQVRKVALFNTAPDNSEERQRKSESFFMETASLERKKRFEK
DIENLPQDIDKDPERRFVHMCIRAEAKSFYQERPHAAALWDGVFTNMPII
DELWGNTFARIDLLQRLADVRMPVYIGLGRYDYLVAPVSLWDAVDGLYPH
VDKVIFEKSGHQPMLEEPEAFDQSFRKWLDQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MERAGICHSDGFDLAYRIEGEGAPILVIGSAAYYPRLFSSDIKQKYQWVF
VDHRGFAKPKRELRAEDSRLDAVLADIERMRTFLQLEDVTTLGHSGHAFM
ALEYARTYPKQVRKVALFNTAPDNSEERQRKSESFFMETASLERKKRFEK
DIENLPQDIDKDPERRFVHMCIRAEAKSFYQERPHAAALWDGVFTNMPII
DELWGNTFARIDLLQRLADVRMPVYIGLGRYDYLVAPVSLWDAVDGLYPH
VDKVIFEKSGHQPMLEEPEAFDQSFRKWLDQ


Reference
    Title: The 25 degrees-36 degrees region of the Bacillus subtilis chromosome: determination of the sequence of a 146 kb segment and identification of 113 genes
    Yamane K, Kumano M, Kurita K
    Ref: Microbiology, 142 ( Pt 11):3047, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer