bacsu-yfhM

 
Bacillus subtilis (and subsp. natto BEST195) yfhM Epoxide_hydrolase like Bsueh

Relationship
Block X
Bacillus subtilis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 1 more: Z99108, AP011541, D85082
2 UniProt : O31581, D4G6M2
1 Ncbi-nid : 2633055
1 Ncbi-pid : 2633182
2 UniProtTrembl : O31581, D4G6M2
2 Interpro : O31581, D4G6M2
2 Prodom : O31581, D4G6M2
2 Pfam : O31581, D4G6M2
2 PIRSF : O31581, D4G6M2
2 SUPERFAM : O31581, D4G6M2
2 QuickSwissBlast : O31581, D4G6M2
 
Sequence
Graphical view for this peptide sequence: bacsu-yfhM
Colored MSA for Epoxide_hydrolase (raw)
MDGVKCQFVNTNGITLHVAAAGREDGPLIVLLHGFPEFWYGWKNQIKPLV
DAGYRVIAPDQRGYNLSDKPEGIDSYRIDTLRDDIIGLITQFTDEKAIVI
GHDWGGAVAWHLASTRPEYLEKLIAINIPHPHVMKTVTPLYPPQWLKSSY
IAYFQLPDIPEASLRENDYDTLDKAIGLSDRPALFTSEDVSRYKEAWKQP
GALTAMLNWYRALRKGSLAEKPSYETVPYRMIWGMEDRFLSRKLAKETER
HCPNGHLIFVDEASHWINHEKPAIVNQLILEYLKNQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDGVKCQFVNTNGITLHVAAAGREDGPLIVLLHGFPEFWYGWKNQIKPLV
DAGYRVIAPDQRGYNLSDKPEGIDSYRIDTLRDDIIGLITQFTDEKAIVI
GHDWGGAVAWHLASTRPEYLEKLIAINIPHPHVMKTVTPLYPPQWLKSSY
IAYFQLPDIPEASLRENDYDTLDKAIGLSDRPALFTSEDVSRYKEAWKQP
GALTAMLNWYRALRKGSLAEKPSYETVPYRMIWGMEDRFLSRKLAKETER
HCPNGHLIFVDEASHWINHEKPAIVNQLILEYLKNQ

Graphical view for this nucleotide DNA sequence (891 bp): bacsu-yfhM



References
1 more
    Title: Whole genome assembly of a natto production strain Bacillus subtilis natto from very short read data
    Nishito Y, Osana Y, Hachiya T, Popendorf K, Toyoda A, Fujiyama A, Itaya M, Sakakibara Y
    Ref: BMC Genomics, 11:243, 2010 : PubMed

            

    Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
    Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)>
    Ref: Nature, 390:249, 1997 : PubMed

            

    Title: Cloning and sequencing of a 27.8-kb nucleotide sequence of the 79 degrees-81 degrees region of the Bacillus subtilis genome containing the sspE locus
    Yamamoto H, Uchiyama S, Sekiguchi J
    Ref: DNA Research, 3:257, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer