bacsu-ytxm

 
Bacillus subtilis, Bacillus sp. ytxm

Comment
Other strains: Bacillus subtilis (and strains BSn5; subsp. spizizenii ATCC 6633; ATCC 23059 / NRRL B-1447; TU-B-10; subsp. subtilis str. SC-8; RO-NN-1 YtxM); Bacillus sp. JS other name ytfB similar to prolyl aminopeptidase pir H70003 (AF008220) trembl O34312


Relationship
Family MenH_SHCHC
Block X
Bacillus subtilis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 7 more: Z99119, AF008220, CP002468
>3 UniProt links 2 more: P23974, D4G0G4, E0TYA6
1 Ncbi-nid : 2635411
1 Ncbi-pid : 2635565
>3 UniProtTrembl links 2 more: P23974, D4G0G4, E0TYA6
>3 Interpro links 2 more: P23974, D4G0G4, E0TYA6
>3 Prodom links 2 more: P23974, D4G0G4, E0TYA6
>3 Pfam links 2 more: P23974, D4G0G4, E0TYA6
>3 PIRSF links 2 more: P23974, D4G0G4, E0TYA6
>3 SUPERFAM links 2 more: P23974, D4G0G4, E0TYA6
>3 QuickSwissBlast links 2 more: P23974, D4G0G4, E0TYA6
 
Sequence
Graphical view for this peptide sequence: bacsu-ytxm
Colored MSA for MenH_SHCHC (raw)
MGTVNITVSDGVRYAVADEGPNASEAVVCLHGFTGSKQSWTFLDEMLPDS
RLIKIDCLGHGETDAPLNGKRYSTTRQVSDLAEIFDQLKLHKVKLIGYSM
GGRLAYSFAMTYPERVSALVLESTTPGLKTLGERRERIMRDRKLADFILR
DGLEAFVAYWENIPLFSSQQRLAEDIRYRIRSGRLRNNKIGLANSLTGMG
TGSQPSLWSRVEEIDVPVLLICGEWDEKFCAINQEVHKMLPSSRIEIVPK
AGHTVHVEQPRLFGKIVSEFLTSI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGTVNITVSDGVRYAVADEGPNASEAVVCLHGFTGSKQSWTFLDEMLPDS
RLIKIDCLGHGETDAPLNGKRYSTTRQVSDLAEIFDQLKLHKVKLIGYSM
GGRLAYSFAMTYPERVSALVLESTTPGLKTLGERRERIMRDRKLADFILR
DGLEAFVAYWENIPLFSSQQRLAEDIRYRIRSGRLRNNKIGLANSLTGMG
TGSQPSLWSRVEEIDVPVLLICGEWDEKFCAINQEVHKMLPSSRIEIVPK
AGHTVHVEQPRLFGKIVSEFLTSI

Graphical view for this nucleotide DNA sequence (854 bp): bacsu-ytxm



References
5 more
    Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
    Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)>
    Ref: Nature, 390:249, 1997 : PubMed

            

    Title: Sequencing and functional annotation of the Bacillus subtilis genes in the 200 kb rrnB-dnaB region.
    Lapidus A, Galleron N, Sorokin A, Ehrlich SD
    Ref: Microbiology, 143:3431, 1997 : PubMed

            

    Title: Structural organization of a Bacillus subtilis operon encoding menaquinone biosynthetic enzymes.
    Rowland B, Hill K, Miller P, Driscoll JR, Taber HW
    Ref: Gene, 167:105, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer