bacsu-yvfQ

 
Bacillus subtilis yvfQ sigma factor sigb CAB08011.1 CAB15415.1 also regulation proteinRsbQ

Comment
Other strains: Bacillus subtilis subsp. natto BEST195 Alpha/beta hydrolase catalytic activity of RsbQ is an essential constituent of the energy stress signaling pathway


Relationship
Family RsbQ-like
Block X
Bacillus subtilis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 1WOM, 1WPR
No kinetic


Inhibitor: PMSF ,
>3 Genbank links 3 more: Z94043, Z99121, CAB15415.1
2 UniProt : O07015, D4G1N6
3 Ncbi-nid : BSZ94043, 16080463, 1945641
1 Ncbi-pid : 1945717
2 Structure : 1WOM, 1WPR
2 UniProtTrembl : O07015, D4G1N6
2 Interpro : O07015, D4G1N6
2 Prodom : O07015, D4G1N6
2 Pfam : O07015, D4G1N6
2 PIRSF : O07015, D4G1N6
2 SUPERFAM : O07015, D4G1N6
2 QuickSwissBlast : O07015, D4G1N6
 
Sequence
Graphical view for this peptide sequence: bacsu-yvfQ
Colored MSA for RsbQ-like (raw)
MNEAILSRNHVKVKGSGKASIMFAPGFGCDQSVWNAVAPAFEEDHRVILF
DYVGSGHSDLRAYDLNRYQTLDGYAQDVLDVCEALDLKETVFVGHSVGAL
IGMLASIRRPELFSHLVMVGPSPCYLNDPPEYYGGFEEEQLLGLLEMMEK
NYIGWATVFAATVLNQPDRPEIKEELESRFCSTDPVIARQFAKAAFFSDH
REDLSKVTVPSLILQCADDIIAPATVGKYMHQHLPYSSLKQMEARGHCPH
MSHPDETIQLIGDYLKAHV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNEAILSRNHVKVKGSGKASIMFAPGFGCDQSVWNAVAPAFEEDHRVILF
DYVGSGHSDLRAYDLNRYQTLDGYAQDVLDVCEALDLKETVFVGHSVGAL
IGMLASIRRPELFSHLVMVGPSPCYLNDPPEYYGGFEEEQLLGLLEMMEK
NYIGWATVFAATVLNQPDRPEIKEELESRFCSTDPVIARQFAKAAFFSDH
REDLSKVTVPSLILQCADDIIAPATVGKYMHQHLPYSSLKQMEARGHCPH
MSHPDETIQLIGDYLKAHV

Graphical view for this nucleotide DNA sequence (839 bp): bacsu-yvfQ



References
2 more
    Title: Catalytic function of an alpha/beta hydrolase is required for energy stress activation of the sigma(B) transcription factor in Bacillus subtilis
    Brody MS, Vijay K, Price CW
    Ref: Journal of Bacteriology, 183:6422, 2001 : PubMed

            

    Title: A PP2C phosphatase containing a PAS domain is required to convey signals of energy stress to the sigmaB transcription factor of Bacillus subtilis
    Vijay K, Brody MS, Fredlund E, Price CW
    Ref: Molecular Microbiology, 35:180, 2000 : PubMed

            

    Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
    Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)>
    Ref: Nature, 390:249, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer