Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bactc-lipas

Bacillus thermocatenulatus triacylglycerol lipase (BTL2)

Comment
Other strains: Bacillus thermocatenulatus; Geobacillus sp. BCO2


Relationship
Family|Bacterial_lip_FamI.5
Block| L
Position in NCBI Life Tree|Bacillus thermocatenulatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Geobacillus: N E > Geobacillus thermoleovorans group: N E > Geobacillus thermocatenulatus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
3 Genbank : X95309, CAA64621, KPC97490
2 UniProt : Q59260, A0A0N0I4H2
1 Ncbi-nid : 1321705
1 Ncbi-pid : 1321706
2 Structure : 5CE5, 2W22
2 UniProt : Q59260, A0A0N0I4H2
2 Interpro : Q59260, A0A0N0I4H2
2 Prodom : Q59260, A0A0N0I4H2
2 Pfam : Q59260, A0A0N0I4H2
2 PIRSF : Q59260, A0A0N0I4H2
2 SUPERFAM : Q59260, A0A0N0I4H2
Sequence
Graphical view for this peptide sequence: bactc-lipas
Colored MSA for Bacterial_lip_FamI.5 (raw)
MMKGCRVMVVLLGLWFVFGLSVPGGRTEAASPRANDAPIVLLHGFTGWGR
EEMLGFKYWGGVRGDIEQWLNDNGYRTYTLAVGPLSSNWDRACEAYAQLV
GGTVDYGAAHAAKHGHARFGRTYPGLLPELKRGGRVHIIAHSQGGQTARM
LVSLLENGSQEEREYAKAHNVSLSPLFEGGHHFVLSVTTIATPHDGTTLV
NMVDFTDRFFDLQKAVLKAAAVASNVPYTSQVYDFKLDQWGLRRQPGESF
DHYFERLKRSPVWTSTDTARYDLSIPGAEKLNQWVQASPNTYYLSFSTER
THRGALTGNYYPELGMNAFSAVVCAPFLGSYRNEALGIDDRWLENDGIVN
TVSMNGPKRGSSDRIVPYDGTLKKGVWNDMGTCNVDHLEVIGVDPNPSFD
IRAFYLRLAEQLASLRP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMKGCRVMVVLLGLWFVFGLSVPGGRTEAASPRANDAPIVLLHGFTGWGR
EEMLGFKYWGGVRGDIEQWLNDNGYRTYTLAVGPLSSNWDRACEAYAQLV
GGTVDYGAAHAAKHGHARFGRTYPGLLPELKRGGRVHIIAHSQGGQTARM
LVSLLENGSQEEREYAKAHNVSLSPLFEGGHHFVLSVTTIATPHDGTTLV
NMVDFTDRFFDLQKAVLKAAAVASNVPYTSQVYDFKLDQWGLRRQPGESF
DHYFERLKRSPVWTSTDTARYDLSIPGAEKLNQWVQASPNTYYLSFSTER
THRGALTGNYYPELGMNAFSAVVCAPFLGSYRNEALGIDDRWLENDGIVN
TVSMNGPKRGSSDRIVPYDGTLKKGVWNDMGTCNVDHLEVIGVDPNPSFD
IRAFYLRLAEQLASLRP


References
12 more
    Title: Investigating the structural properties of the active conformation BTL2 of a lipase from Geobacillus thermocatenulatus in toluene using molecular dynamic simulations and engineering BTL2 via in-silico mutation
    Yenenler A, Venturini A, Burduroglu HC, Sezerman OU
    Ref: J Mol Model, 24:229, 2018 : PubMed

            

    Title: Study the effect of F17S mutation on the chimeric Bacillus thermocatenulatus lipase
    Khaleghinejad SH, Motalleb G, Karkhane AA, Aminzadeh S, Yakhchali B
    Ref: J Genet Eng Biotechnol, 14:83, 2016 : PubMed

            

    Title: Modifying the catalytic preference of tributyrin in Bacillus thermocatenulatus lipase through in-silico modeling of enzyme-substrate complex
    Durmaz E, Kuyucak S, Sezerman UO
    Ref: Protein Engineering Des Sel, 26:325, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer