Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bactu-a0a0s3byn5

Bacillus thuringiensis Uncharacterized protein

Comment
Other strains: Bacillus thuringiensis; Bacillus thuringiensis subsp.; Bacillus anthracis; Bacillus cereus


Relationship
Family|UCP033634
Block| X
Position in NCBI Life Tree|Bacillus thuringiensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus thuringiensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: bactu-a0a0s3byn5
Colored MSA for UCP033634 (raw)
MKGTKKEVHINDKVIRYTHIEKGSSTVCFMFSGSGYNYDKPLFYYATMLM
LEHKIDVVHIHYSYDEQVMNKPIEELTKVMMDDIYPIMNEVLKGEQYNET
LFLGKSLGTIPIANDVMKREEFLQSKMILLTPLLTFESIFDSILHSQHEG
LLVIGDKDHQYNADQVKQLYKTNLTIDVIKNANHSVNVGGYETGNSIEAI
ANIMRKLKETISTIKVEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKGTKKEVHINDKVIRYTHIEKGSSTVCFMFSGSGYNYDKPLFYYATMLM
LEHKIDVVHIHYSYDEQVMNKPIEELTKVMMDDIYPIMNEVLKGEQYNET
LFLGKSLGTIPIANDVMKREEFLQSKMILLTPLLTFESIFDSILHSQHEG
LLVIGDKDHQYNADQVKQLYKTNLTIDVIKNANHSVNVGGYETGNSIEAI
ANIMRKLKETISTIKVEL



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer