Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacwk-a9vkh7

Bacillus weihenstephanensis (strain KBAB4) Alpha/beta hydrolase fold

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Bacillus weihenstephanensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus mycoides: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000903
1 UniProt : A9VKH7
1 UniProt : A9VKH7
1 Interpro : A9VKH7
1 Prodom : A9VKH7
1 Pfam : A9VKH7
1 PIRSF : A9VKH7
1 SUPERFAM : A9VKH7
Sequence
Graphical view for this peptide sequence: bacwk-a9vkh7
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MWTQQIINTKRGTFELFTKGNGEPLCITHHYSQFNETGDYFADVFTATHR
VLLINLRNAGNSAKAHSEKELSMIETVHDLEAIREALQLPTWHFAGHSTG
GMLGLLYTITYPTSLQSLVMAGAAASNYTETLFCIYHPEHSQFHYMQQLI
ENLKSPHLTNAERKELSTKRTKLSLYKPENYNSYFCKPIQKTMSASRMNT
FANEYPSFDLRENLPSIQTKTLIICGRHDVQCPIQYSIEMHEGIRNSIFV
PFEDSNHYPFLEEASRFTSITQEFFGIKKKIKDSQRQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWTQQIINTKRGTFELFTKGNGEPLCITHHYSQFNETGDYFADVFTATHR
VLLINLRNAGNSAKAHSEKELSMIETVHDLEAIREALQLPTWHFAGHSTG
GMLGLLYTITYPTSLQSLVMAGAAASNYTETLFCIYHPEHSQFHYMQQLI
ENLKSPHLTNAERKELSTKRTKLSLYKPENYNSYFCKPIQKTMSASRMNT
FANEYPSFDLRENLPSIQTKTLIICGRHDVQCPIQYSIEMHEGIRNSIFV
PFEDSNHYPFLEEASRFTSITQEFFGIKKKIKDSQRQ


Reference
    Title: Extending the Bacillus cereus group genomics to putative food-borne pathogens of different toxicity
    Lapidus A, Goltsman E, Auger S, Galleron N, Segurens B, Dossat C, Land ML, Broussolle V, Brillard J and Sorokin A <8 more author(s)>
    Ref: Chemico-Biological Interactions, 171:236, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer