Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: biflo-BL0807

Bifidobacterium longum, Bifidobacterium breve, Bifidobacterium sp., hypothetical protein with similarity to lipases and esterases

Comment
Other strains: Bifidobacterium longum (strain NCC 2705; DJO10A; subsp. longum (ATCC 55813; BBMN68; F8; ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b); subsp. infantis (strain 157F; ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)), Bifidobacterium breve DSM 20213 = JCM 1192, Bifidobacterium sp. 12_1_47BFAA


Relationship
Family|BD-FAE
Block| H
Position in NCBI Life Tree|Bifidobacterium longum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Bifidobacteriales: N E > Bifidobacteriaceae: N E > Bifidobacterium: N E > Bifidobacterium longum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AE014702
>3 UniProt links 5 more: Q8G643, C2GX34, E5Y004
>3 UniProt links 5 more: Q8G643, C2GX34, E5Y004
>3 Interpro links 5 more: Q8G643, C2GX34, E5Y004
>3 Pfam links 5 more: Q8G643, C2GX34, E5Y004
>3 PIRSF links 5 more: Q8G643, C2GX34, E5Y004
>3 SUPERFAM links 5 more: Q8G643, C2GX34, E5Y004
Sequence
Graphical view for this peptide sequence: biflo-BL0807
Colored MSA for BD-FAE (raw)
MQTIDSSKAAENVTGSDGAIHIPSNPTLAGLASLTRNVAYKTGADDLVMD
IIAPQSTGDDDNRRYPTVIFVQGSAWTTPHRDYEIPQLSALAREGFVVAT
VNHRDASSDPHDVFPAYLEDVKAAIRYLRANARQWHVDPDRLGIWGTSSG
GNTSLLVGLTADDPRYEDGTNADESDTVKYVVSCFPPTDMLEAVDAFDDE
TNPFRLYYFGPFAAVVGATHETGINAEVRQRAADMSPYLQVRDGRQYPPM
LLLHGTADTVVPYHQSVKMRDRLVEHDVDAQLVLVDGAEHEYDFWSQQVF
DVIFDFIRERS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQTIDSSKAAENVTGSDGAIHIPSNPTLAGLASLTRNVAYKTGADDLVMD
IIAPQSTGDDDNRRYPTVIFVQGSAWTTPHRDYEIPQLSALAREGFVVAT
VNHRDASSDPHDVFPAYLEDVKAAIRYLRANARQWHVDPDRLGIWGTSSG
GNTSLLVGLTADDPRYEDGTNADESDTVKYVVSCFPPTDMLEAVDAFDDE
TNPFRLYYFGPFAAVVGATHETGINAEVRQRAADMSPYLQVRDGRQYPPM
LLLHGTADTVVPYHQSVKMRDRLVEHDVDAQLVLVDGAEHEYDFWSQQVF
DVIFDFIRERS


References
2 more
    Title: Bifidobacteria can protect from enteropathogenic infection through production of acetate
    Fukuda S, Toh H, Hase K, Oshima K, Nakanishi Y, Yoshimura K, Tobe T, Clarke JM, Topping DL and Ohno H <6 more author(s)>
    Ref: Nature, 469:543, 2011 : PubMed

            

    Title: The genome sequence of Bifidobacterium longum subsp. infantis reveals adaptations for milk utilization within the infant microbiome
    Sela DA, Chapman J, Adeuya A, Kim JH, Chen F, Whitehead TR, Lapidus A, Rokhsar DS, Lebrilla CB and Mills DA <3 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 105:18964, 2008 : PubMed

            

    Title: The genome sequence of Bifidobacterium longum reflects its adaptation to the human gastrointestinal tract
    Schell MA, Karmirantzou M, Snel B, Vilanova D, Berger B, Pessi G, Zwahlen MC, Desiere F, Bork P and Arigoni F <2 more author(s)>
    Ref: Proceedings of the National Academy of Sciences of the United States of America, 99:14422, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer