Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: boomi-ACHE1

Rhipicephalus microplus (Cattle tick) (Boophilus microplus) acetylcholinesterase 1

Comment
The following mutations were found associated with OP resistant strains, but were also found in susceptible strains and were not characterized biochemically. Consequently they are not introduced individually in ESTHER; P157S, E195G, Y230C, S282G, T362A, L417P, Q488R, I493T, W571R, W571F see Swale et al. 2013 Temeyer 2018


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Boophilus microplus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Chelicerata: N E > Arachnida: N E > Acari: N E > Parasitiformes: N E > Ixodida: N E > Ixodoidea: N E > Ixodidae: N E > Rhipicephalinae: N E > Rhipicephalus [genus]: N E > Boophilus: N E > Rhipicephalus microplus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
3 mutations: TableD188G/E196G/V331A/F390S, G142S, V331A/F390S
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AJ223965
1 Ncbi-nid : 2832784
1 Ncbi-pid : 2832785
2 UniProt : O45210, A0A0F6P2D6
2 Interpro : O45210, A0A0F6P2D6
2 Prodom : O45210, A0A0F6P2D6
2 Pfam : O45210, A0A0F6P2D6
2 PIRSF : O45210, A0A0F6P2D6
2 SUPERFAM : O45210, A0A0F6P2D6
Sequence
Graphical view for this peptide sequence: boomi-ACHE1
Colored MSA for ACHE (raw)
MDPEQDMLHENLASCHLTLLALLVCGGVVLRCLSIEPEEDASNRVEDQDA
EDPVETVVVETAWGPVKGFIAQSPLGKPVRVFYGIPYAKPPTGKRRFDRA
ESIEEPWTDVLDATVKPNSCFQVLDTLYGNFSGSTMWNANTEMSEDCLKL
NVWAPGPPTSSGGRPLAVLVWIYGGGFYSGTSTLDVYDARTLVSEENVVV
VSMNYRVASLGFLSFGNETLPGNAGLYDQYMALKWVQENVAAFGGDPDRV
TLFGESAGAASAGLHVLSPLSESLFHRVILQSGSPAVPWGFQDRDKARQS
AKKLATALRAPDSLDQETLDSLRCERPEDIVNNETNSGGVVDFPFVPVAD
GVFLPDTPQALTDKGSFARNISVMLGSNANEGSWFLQYFFGFPVTDETPE
VTKENFTAVLEALDPSLEQTPIAEIMKTYTAGEIPSTAADILKALDSIVG
DYHFTCPVVRWADTFARAGIPVYQYVFARRSSQNPWPQWTGVIHGEEVPF
VFGEPLNDTYCYSEEDKTLSRRIMRYWANFAKTGNPNLPEDGSPGSTIRW
PERTDSLKRHLVLDVNESVGWAHRQTYCDFWENVRRNRTPPVPSC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDPEQDMLHENLASCHLTLLALLVCGGVVLRCLSIEPEEDASNRVEDQDA
EDPVETVVVETAWGPVKGFIAQSPLGKPVRVFYGIPYAKPPTGKRRFDRA
ESIEEPWTDVLDATVKPNSCFQVLDTLYGNFSGSTMWNANTEMSEDCLKL
NVWAPGPPTSSGGRPLAVLVWIYGGGFYSGTSTLDVYDARTLVSEENVVV
VSMNYRVASLGFLSFGNETLPGNAGLYDQYMALKWVQENVAAFGGDPDRV
TLFGESAGAASAGLHVLSPLSESLFHRVILQSGSPAVPWGFQDRDKARQS
AKKLATALRAPDSLDQETLDSLRCERPEDIVNNETNSGGVVDFPFVPVAD
GVFLPDTPQALTDKGSFARNISVMLGSNANEGSWFLQYFFGFPVTDETPE
VTKENFTAVLEALDPSLEQTPIAEIMKTYTAGEIPSTAADILKALDSIVG
DYHFTCPVVRWADTFARAGIPVYQYVFARRSSQNPWPQWTGVIHGEEVPF
VFGEPLNDTYCYSEEDKTLSRRIMRYWANFAKTGNPNLPEDGSPGSTIRW
PERTDSLKRHLVLDVNESVGWAHRQTYCDFWENVRRNRTPPVPSC


References
5 more
    Title: Baculoviral Expression of Presumptive OP-Resistance Mutations in BmAChE1 of Rhipicephalus (Boophilus) microplus (Ixodida: Ixodidae) and Biochemical Resistance to OP Inhibition
    Temeyer KB, Schlechte KG, McDonough WP
    Ref: Journal of Medical Entomology, 56:1318, 2019 : PubMed

            

    Title: Baculovirus expression, biochemical characterization and organophosphate sensitivity of rBmAChE1, rBmAChE2, and rBmAChE3 of Rhipicephalus (Boophilus) microplus
    Temeyer KB, Pruett JH, Olafson PU
    Ref: Vet Parasitol, 172:114, 2010 : PubMed

            

    Title: Acetylcholinesterase cDNA of the cattle tick, Boophilus microplus: characterisation and role in organophosphate resistance
    Baxter GD, Barker SC
    Ref: Insect Biochemistry & Molecular Biology, 28:581, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer