Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: boomi-ACHE3

Boophilus microplus (Cattle tick) putative acetylcholinesterase 3 AChE3 mRNA

Comment
R86Q mutant exhibits 19.2-fold reduced sensitivity to paraoxon. The following mutations were found associated with OP resistant strains, but were also found in susceptible strains and were not characterized biochemically, I48L, I54V, V71A, I77M, S79P, I123M, I492M, T548A, T548Y see: Jyoti et al. 2016


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Boophilus microplus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Chelicerata: N E > Arachnida: N E > Acari: N E > Parasitiformes: N E > Ixodida: N E > Ixodoidea: N E > Ixodidae: N E > Rhipicephalinae: N E > Rhipicephalus [genus]: N E > Boophilus: N E > Rhipicephalus microplus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
9 mutations: Table (e.g. : I48L, I492M, I54V ... more)
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: boomi-ACHE3
Colored MSA for ACHE (raw)
MYSRIVVLLLYGYALRSAHARCYIFQPGDPIQDTDEKIYLAQPFNVTIPL
EAGIPTTAQPASTGKDQLSLVVPPDDIQSLSTTTSRPISTEESPIVETNS
GPVQGRRVYAANRTLYQFVGIPFAEPPVGPLRFRNPVPVKPWSSVYQATK
KPFPCLQTDFYINSNVTIPTANSSEDCLYLNVWTPSRECVLGKFSCVPKT
VIVYIYGGTFSFGSSGWDWYDGKEFVARGDVVMVSMNYRVGPMGFFHSGT
THSSGNAGLHDQLLAMKWVKQNIRNFGGDPDDVTLVGQSAGAISIGLHLV
SPLSKGLFKRIIMESGSPYFRIADNTREGPHKVEKLARALQCARNDMTIE
SHMAEMVECLRKIDGKELLIMSNTIFGVHALTFFPVFGDDIIPDDPYLMM
EQKKFHKADLLIGNNLDEGSYFVFYLFGRALDLEQAHKITKYEVDLYVSY
CLQMLLRKNVSPIRHYYLSHIGERENIKALQKAAEAVGDFAIICPTKYFA
ESFASMNNKVHYYYFTHRPSFSTWPGWVGPTHGDEVFFVMGLPFSSPTIA
TDQERELSKLMIETWTTFAKTGKVPDVASKPWPEFTAKNQVYMELNPKRY
TYGRGPNEKNCNFWKSYLKPRGPNEKNCNFWKSYLKP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYSRIVVLLLYGYALRSAHARCYIFQPGDPIQDTDEKIYLAQPFNVTIPL
EAGIPTTAQPASTGKDQLSLVVPPDDIQSLSTTTSRPISTEESPIVETNS
GPVQGRRVYAANRTLYQFVGIPFAEPPVGPLRFRNPVPVKPWSSVYQATK
KPFPCLQTDFYINSNVTIPTANSSEDCLYLNVWTPSRECVLGKFSCVPKT
VIVYIYGGTFSFGSSGWDWYDGKEFVARGDVVMVSMNYRVGPMGFFHSGT
THSSGNAGLHDQLLAMKWVKQNIRNFGGDPDDVTLVGQSAGAISIGLHLV
SPLSKGLFKRIIMESGSPYFRIADNTREGPHKVEKLARALQCARNDMTIE
SHMAEMVECLRKIDGKELLIMSNTIFGVHALTFFPVFGDDIIPDDPYLMM
EQKKFHKADLLIGNNLDEGSYFVFYLFGRALDLEQAHKITKYEVDLYVSY
CLQMLLRKNVSPIRHYYLSHIGERENIKALQKAAEAVGDFAIICPTKYFA
ESFASMNNKVHYYYFTHRPSFSTWPGWVGPTHGDEVFFVMGLPFSSPTIA
TDQERELSKLMIETWTTFAKTGKVPDVASKPWPEFTAKNQVYMELNPKRY
TYGRGPNEKNCNFWKSYLKPRGPNEKNCNFWKSYLKP


References
8 more
    Title: Multiple mutations in the acetylcholinesterase 3 gene associated with organophosphate resistance in Rhipicephalus (Boophilus) microplus ticks from Punjab, India
    Jyoti, Singh NK, Singh H, Rath SS
    Ref: Vet Parasitol, 216:108, 2016 : PubMed

            

    Title: Baculovirus expression, biochemical characterization and organophosphate sensitivity of rBmAChE1, rBmAChE2, and rBmAChE3 of Rhipicephalus (Boophilus) microplus
    Temeyer KB, Pruett JH, Olafson PU
    Ref: Vet Parasitol, 172:114, 2010 : PubMed

            

    Title: R86Q, a mutation in BmAChE3 yielding a Rhipicephalus microplus organophosphate-insensitive acetylcholinesterase
    Temeyer KB, Pruett JH, Olafson PU, Chen AC
    Ref: Journal of Medical Entomology, 44:1013, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer