Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: borpe-q7vv48

Bordetella pertussis; Bordetella bronchiseptica hypothetical protein

Comment
Other strains: Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323); Bordetella bronchiseptica (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)


Relationship
Family|Xaa-Pro-like_dom
Block| X
Position in NCBI Life Tree|Bordetella pertussis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Alcaligenaceae: N E > Bordetella: N E > Bordetella pertussis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : BX640419, WP_014906015
1 UniProt : Q7VV48
2 UniProt : Q7VV48, A0A0T7CSQ6
2 Interpro : Q7VV48, A0A0T7CSQ6
2 Prodom : Q7VV48, A0A0T7CSQ6
2 Pfam : Q7VV48, A0A0T7CSQ6
2 PIRSF : Q7VV48, A0A0T7CSQ6
2 SUPERFAM : Q7VV48, A0A0T7CSQ6
Sequence
Graphical view for this peptide sequence: borpe-q7vv48
Colored MSA for Xaa-Pro-like_dom (raw)
MSESWQGRAAPNGSAEPIEFMLDGDCIRGTFYRPAGAGAPVPAVVLAHGW
SMVAGGDLEDYAAAVVNRGLAALTFDFRNLGKSGSLPRQEIDPYRQVEDF
RAAISYVRGRPEVDRERIGIWGSSYSGGHALTVAAIDRRVKCVVSQVPTT
SGFSAAQRRVRYDKAQALQAAFEADREARFAGAEPATLRMVDPDPEAPVA
YPGPDSYRYMTGEARRCPQWVNAVTLRSLELARTYEPGVYARRIAPTPLL
MIVAASDGLTPADLQQDAFNNAQQPKELLLLPGGHYSVYTDHFDRTSQAA
ADWFALHLR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSESWQGRAAPNGSAEPIEFMLDGDCIRGTFYRPAGAGAPVPAVVLAHGW
SMVAGGDLEDYAAAVVNRGLAALTFDFRNLGKSGSLPRQEIDPYRQVEDF
RAAISYVRGRPEVDRERIGIWGSSYSGGHALTVAAIDRRVKCVVSQVPTT
SGFSAAQRRVRYDKAQALQAAFEADREARFAGAEPATLRMVDPDPEAPVA
YPGPDSYRYMTGEARRCPQWVNAVTLRSLELARTYEPGVYARRIAPTPLL
MIVAASDGLTPADLQQDAFNNAQQPKELLLLPGGHYSVYTDHFDRTSQAA
ADWFALHLR


Reference
    Title: Comparative analysis of the genome sequences of Bordetella pertussis, Bordetella parapertussis and Bordetella bronchiseptica
    Parkhill J, Sebaihia M, Preston A, Murphy LD, Thomson N, Harris DE, Holden MT, Churcher CM, Bentley SD and Maskell DJ <43 more author(s)>
    Ref: Nat Genet, 35:32, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer