Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: borpe-q7w073

Bordetella pertussis Bordetella parapertussis Bordetella bronchiseptica (Alcaligenes bronchisepticus) putative acetyl esterase

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Bordetella pertussis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Alcaligenaceae: N E > Bordetella: N E > Bordetella pertussis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : BX640424, BX640438, BX640411
2 UniProt : Q7WCA2, Q7W073
2 UniProt : Q7WCA2, Q7W073
2 Interpro : Q7WCA2, Q7W073
2 Prodom : Q7WCA2, Q7W073
2 Pfam : Q7WCA2, Q7W073
2 PIRSF : Q7WCA2, Q7W073
2 SUPERFAM : Q7WCA2, Q7W073
Sequence
Graphical view for this peptide sequence: borpe-q7w073
Colored MSA for Hormone-sensitive_lipase_like (raw)
MTTAALPYPLDPQIQRFVERMQADSAAHPRRDLVPVEQAHAISEAVRRPW
AEGGPQMARTREIHVPTPHGPVRLRVYTPRAARPGPALLYVHGGGWVLFS
LDTHDRLMREYAERAGLTVIGVDYTRAPEARYPRAIEEIVGVIDWLDAHG
AELEVDRARLCIGGDSAGANLSVAACLTLRERGAAPLAGMVLNYGVYDAN
LFRDSTVKYGGGEYLLSTQQMVWFYWNYLRAGDDPRDPRISPVHADLRGL
PPAFMAITELDLLHDTNQDMAARLREAGVDVQAKVYPGTVHSFLEAVSLA
QVSVAAFDDTAAWLRAVLRPDAAAAAIHTGEHQP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTTAALPYPLDPQIQRFVERMQADSAAHPRRDLVPVEQAHAISEAVRRPW
AEGGPQMARTREIHVPTPHGPVRLRVYTPRAARPGPALLYVHGGGWVLFS
LDTHDRLMREYAERAGLTVIGVDYTRAPEARYPRAIEEIVGVIDWLDAHG
AELEVDRARLCIGGDSAGANLSVAACLTLRERGAAPLAGMVLNYGVYDAN
LFRDSTVKYGGGEYLLSTQQMVWFYWNYLRAGDDPRDPRISPVHADLRGL
PPAFMAITELDLLHDTNQDMAARLREAGVDVQAKVYPGTVHSFLEAVSLA
QVSVAAFDDTAAWLRAVLRPDAAAAAIHTGEHQP


Reference
    Title: Comparative analysis of the genome sequences of Bordetella pertussis, Bordetella parapertussis and Bordetella bronchiseptica
    Parkhill J, Sebaihia M, Preston A, Murphy LD, Thomson N, Harris DE, Holden MT, Churcher CM, Bentley SD and Maskell DJ <43 more author(s)>
    Ref: Nat Genet, 35:32, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer