Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bovin-ABHD16B

Bos taurus (Bovine); Bos mutus (wild yak) Abhydrolase domain containing 16B

Comment
Other strains: Bos taurus (Bovine); Bos mutus (wild yak) Shan et al. identified a nonsense mutation in the bovine Abhydrolase domain containing 16B gene ABHD16B (SNP rs468948776 AC_000170 g.54429815G>A) associated with male subfertility in Holstein cattle. The mutation causes a premature stop codon at amino acid position Glu 218, resulting in a truncation of 235 C-terminal amino acids. ABHD16B is involved in lipid biosynthesis in testis and is crucial for fertilization


Relationship
Family|ABHD16
Block| X
Position in NCBI Life Tree|Bos taurus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Ruminantia: N E > Pecora: N E > Bovidae: N E > Bovinae: N E > Bos: N E > Bos taurus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: BC109991, JH885601, NP_001033630
2 UniProt : Q32KP4, L8HLM5
2 UniProt : Q32KP4, L8HLM5
2 Interpro : Q32KP4, L8HLM5
2 Prodom : Q32KP4, L8HLM5
2 Pfam : Q32KP4, L8HLM5
2 PIRSF : Q32KP4, L8HLM5
2 SUPERFAM : Q32KP4, L8HLM5
Sequence
Graphical view for this peptide sequence: bovin-ABHD16B
Colored MSA for ABHD16 (raw)
MCVVCFVKALVHVFKIYLTANYTYNFRGWPVDFRWDDVRAAAGSGSSHRA
LTCAAAAAGVWLLRGAALGEDSPVRLPRAARSQAQCLLQQIRELPSQLAS
YALAHSLGRWLVYPGSMFLMTRALLPLLQQGQERLVERYRGRRAKLVACD
GNEIDTMFMDRRQDPGSHGRGLRLVICCEGNAGFYEMGCLSAPLEAGYSV
LGWNHPGFGGSTGAPFPQHDANAMDVVVKYALHRLHFPPAHVVVYGWSIG
GFTATWATMTYPELGALVLDATFDDLVPLALKVMPHSWKGLVVRTVREHF
NLNVAEQLCRYPGPVLLLRRTQDDVVSTAGHLRPLPSGVVEGNRGNELLL
RLLQHRYPAVMAREGLAIVTRWLRAGSLAQEAAFYARYRVDDEWCLSLLR
SYLTHCEDQQEDEETWGSHGLAFPWLVGQGLSPRRRRQLALFLARKHLKN
VEATHCSPLEPEDFQLPWRL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCVVCFVKALVHVFKIYLTANYTYNFRGWPVDFRWDDVRAAAGSGSSHRA
LTCAAAAAGVWLLRGAALGEDSPVRLPRAARSQAQCLLQQIRELPSQLAS
YALAHSLGRWLVYPGSMFLMTRALLPLLQQGQERLVERYRGRRAKLVACD
GNEIDTMFMDRRQDPGSHGRGLRLVICCEGNAGFYEMGCLSAPLEAGYSV
LGWNHPGFGGSTGAPFPQHDANAMDVVVKYALHRLHFPPAHVVVYGWSIG
GFTATWATMTYPELGALVLDATFDDLVPLALKVMPHSWKGLVVRTVREHF
NLNVAEQLCRYPGPVLLLRRTQDDVVSTAGHLRPLPSGVVEGNRGNELLL
RLLQHRYPAVMAREGLAIVTRWLRAGSLAQEAAFYARYRVDDEWCLSLLR
SYLTHCEDQQEDEETWGSHGLAFPWLVGQGLSPRRRRQLALFLARKHLKN
VEATHCSPLEPEDFQLPWRL


References
    Title: alpha/beta-Hydrolase D16B Truncation Results in Premature Sperm Capacitation in Cattle
    Shan S, Xu F, Hirschfeld M, Herrmann C, Schulze M, Sharifi AR, Hoelker M, Brenig B
    Ref: Int J Mol Sci, 23:, 2022 : PubMed

            

    Title: Association of alpha/beta-Hydrolase D16B with Bovine Conception Rate and Sperm Plasma Membrane Lipid Composition
    Shan S, Xu F, Bleyer M, Becker S, Melbaum T, Wemheuer W, Hirschfeld M, Wacker C, Zhao S and Brenig B <1 more author(s)>
    Ref: Int J Mol Sci, 21:, 2020 : PubMed

            

    Title: The yak genome and adaptation to life at high altitude
    Qiu Q, Zhang G, Ma T, Qian W, Wang J, Ye Z, Cao C, Hu Q, Kim J and Liu J <35 more author(s)>
    Ref: Nat Genet, 44:946, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer