Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bovin-ABHDA

Bos taurus (Bovine); Bos mutus (wild yak) abhydrolase domain containing 10

Comment
Other strains: Bos taurus (Bovine); Bos mutus (wild yak)


Relationship
Family|ABHD10
Block| X
Position in NCBI Life Tree|Bos taurus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Ruminantia: N E > Pecora: N E > Bovidae: N E > Bovinae: N E > Bos: N E > Bos taurus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: BT020941, BC112739, NP_001015606
2 UniProt : Q5E9H9, L8I903
2 UniProt : Q5E9H9, L8I903
2 Interpro : Q5E9H9, L8I903
2 Prodom : Q5E9H9, L8I903
2 Pfam : Q5E9H9, L8I903
2 PIRSF : Q5E9H9, L8I903
2 SUPERFAM : Q5E9H9, L8I903
Sequence
Graphical view for this peptide sequence: bovin-ABHDA
Colored MSA for ABHD10 (raw)
MAGVGLAAVPAWVPCRRWGLAAVTFGFHHGLSTLLARKTERAPQWLRACR
HKTSISFLSRPDLPNLAYKRLKGKSPGIIFIPGYISNMNGTKALAIEEFC
KSLGHAYIRFDYSGVGNSDGNLEECTVGKWRKDVLSIIDDLAEGPQILVG
SSLGGWLMFHAAIARPQKVVALVGVATAVDGLVTQFNQLPIETKKEIEMK
GVWPMPSKYSEEGVYRIQYSVIKEAEHHCLLHSPIPVKCPVRLLHGMKDD
IVPWHTSVQVADRVVSTDVDVILRKNSDHRMKEKADIQLLVYTIDDLIDK
LSTIVH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAGVGLAAVPAWVPCRRWGLAAVTFGFHHGLSTLLARKTERAPQWLRACR
HKTSISFLSRPDLPNLAYKRLKGKSPGIIFIPGYISNMNGTKALAIEEFC
KSLGHAYIRFDYSGVGNSDGNLEECTVGKWRKDVLSIIDDLAEGPQILVG
SSLGGWLMFHAAIARPQKVVALVGVATAVDGLVTQFNQLPIETKKEIEMK
GVWPMPSKYSEEGVYRIQYSVIKEAEHHCLLHSPIPVKCPVRLLHGMKDD
IVPWHTSVQVADRVVSTDVDVILRKNSDHRMKEKADIQLLVYTIDDLIDK
LSTIVH


References
    Title: The yak genome and adaptation to life at high altitude
    Qiu Q, Zhang G, Ma T, Qian W, Wang J, Ye Z, Cao C, Hu Q, Kim J and Liu J <35 more author(s)>
    Ref: Nat Genet, 44:946, 2012 : PubMed

            

    Title: Characterization of 954 bovine full-CDS cDNA sequences
    Harhay GP, Sonstegard TS, Keele JW, Heaton MP, Clawson ML, Snelling WM, Wiedmann RT, Van Tassell CP, Smith TP
    Ref: BMC Genomics, 6:166, 2005 : PubMed

            

    Title: Sequence evaluation of four pooled-tissue normalized bovine cDNA libraries and construction of a gene index for cattle
    Smith TP, Grosse WM, Freking BA, Roberts AJ, Stone RT, Casas E, Wray JE, White J, Cho J and Keele JW <11 more author(s)>
    Ref: Genome Res, 11:626, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer