Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bovin-TEX30

Bos taurus (Bovine), Bos mutus (Yak) Testis-expressed sequence 30 protein, C13orf27 homolog

Comment
old CM027_BOVIN bovin-cm027


Relationship
Family|NLS3-Tex30
Block| X
Position in NCBI Life Tree|Bos taurus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Ruminantia: N E > Pecora: N E > Bovidae: N E > Bovinae: N E > Bos: N E > Bos taurus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : BC102911, JH883767
2 UniProt : Q3ZC52, L8HPZ0
2 UniProt : Q3ZC52, L8HPZ0
2 Interpro : Q3ZC52, L8HPZ0
2 Prodom : Q3ZC52, L8HPZ0
2 Pfam : Q3ZC52, L8HPZ0
2 PIRSF : Q3ZC52, L8HPZ0
2 SUPERFAM : Q3ZC52, L8HPZ0
Sequence
Graphical view for this peptide sequence: bovin-TEX30
Colored MSA for NLS3-Tex30 (raw)
MSHTEVKLKVPFGNKLLDAVCLVPNKSLTYGVILTHGASGDMNLPHLTSL
ASHLASHGFFCLRFTCKGLNIVHRIKAYKSVLNYLKTSEYKLAGVFLGGR
SMGSRAAASVLCHIEPDDADDFVRGLICISYPLHHPKQQHKLRDEDLFRI
KDPVLFVSGSADEMCEKNLLEKVAQKMQAPHKIHWIEKANHSMAVKGRST
NDVFKEINTQILFWIQEITETDKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSHTEVKLKVPFGNKLLDAVCLVPNKSLTYGVILTHGASGDMNLPHLTSL
ASHLASHGFFCLRFTCKGLNIVHRIKAYKSVLNYLKTSEYKLAGVFLGGR
SMGSRAAASVLCHIEPDDADDFVRGLICISYPLHHPKQQHKLRDEDLFRI
KDPVLFVSGSADEMCEKNLLEKVAQKMQAPHKIHWIEKANHSMAVKGRST
NDVFKEINTQILFWIQEITETDKK


Reference
    Title: The yak genome and adaptation to life at high altitude
    Qiu Q, Zhang G, Ma T, Qian W, Wang J, Ye Z, Cao C, Hu Q, Kim J and Liu J <35 more author(s)>
    Ref: Nat Genet, 44:946, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer