Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bovin-pafa

Bovine plasma PAF acetylhydrolase

Relationship
Family|PAF-Acetylhydrolase
Block| X
Position in NCBI Life Tree|Bos taurus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Ruminantia: N E > Pecora: N E > Bovidae: N E > Bovinae: N E > Bos: N E > Bos taurus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : U34247, BC114827
1 UniProt : Q28017
1 Ncbi-nid : 1054898
1 Ncbi-pid : 1054899
2 UniProt : Q28017, Q1RML9
2 Interpro : Q28017, Q1RML9
2 Prodom : Q28017, Q1RML9
2 Pfam : Q28017, Q1RML9
2 PIRSF : Q28017, Q1RML9
2 SUPERFAM : Q28017, Q1RML9
Sequence
Graphical view for this peptide sequence: bovin-pafa
Colored MSA for PAF-Acetylhydrolase (raw)
MLPSKLHALFCLCTCLALVYPFDWQDLNPVAYIESPAWVSKIQALMAAAN
IGQSKIPRGNGSYSVGCTDLMFDYTNKGTFLRLYYPSQDDDHSDTLWIPN
KEYFLGLSKFLGTHWLVGKIMGLFFGSMTTPAAWNAHLRTGEKYPLIIFS
HGLGAFRTIYSAIGIDLASHGFIVAAVEHRDGSASSTYYFKDQSAVEIGN
KSWLYLRTLKRGEEEFPLRNEQLRQRAKECSQALSLILDIDHGRPVTNVL
DLEFDVEQLKDSIDRDKIAIIGHSFGGATVIQTLSEDQRFRCGIALDAWM
FPVGDEVYSRIPQPLFFINSERFQYPSNIIRMKKCFLPDRERKMITIRGS
VHQNFVDFTFATSKIIGYLFTLKGDIDSNVAISLSNKASLAFLQKHLGLQ
KDFDQWDSLVEGEDHNLIPGTNINTTNHQAILQNSTGIERPNLD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLPSKLHALFCLCTCLALVYPFDWQDLNPVAYIESPAWVSKIQALMAAAN
IGQSKIPRGNGSYSVGCTDLMFDYTNKGTFLRLYYPSQDDDHSDTLWIPN
KEYFLGLSKFLGTHWLVGKIMGLFFGSMTTPAAWNAHLRTGEKYPLIIFS
HGLGAFRTIYSAIGIDLASHGFIVAAVEHRDGSASSTYYFKDQSAVEIGN
KSWLYLRTLKRGEEEFPLRNEQLRQRAKECSQALSLILDIDHGRPVTNVL
DLEFDVEQLKDSIDRDKIAIIGHSFGGATVIQTLSEDQRFRCGIALDAWM
FPVGDEVYSRIPQPLFFINSERFQYPSNIIRMKKCFLPDRERKMITIRGS
VHQNFVDFTFATSKIIGYLFTLKGDIDSNVAISLSNKASLAFLQKHLGLQ
KDFDQWDSLVEGEDHNLIPGTNINTTNHQAILQNSTGIERPNLD


References
    Title: Anti-inflammatory properties of a platelet-activating factor acetylhydrolase
    Tjoelker LW, Wilder C, Eberhardt C, Stafforini DM
    Ref: Nature, 374:549, 1995 : PubMed

            

    Title: Plasma platelet-activating factor acetylhydrolase is a secreted phospholipase A2 with a catalytic triad
    Tjoelker LW, Eberhardt C, Unger J, Le Trong H, Zimmerman GA
    Ref: Journal of Biological Chemistry, 270:25481, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer