Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bovin-q3t0r6

Bos taurus (Bovine), Bos mutus (Yak) hypothetical protein mgc127393

Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Bos taurus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Ruminantia: N E > Pecora: N E > Bovidae: N E > Bovinae: N E > Bos: N E > Bos taurus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : BC102288, AAFC03046191, JH881196
3 UniProt : Q3T0R6, F1MU22, L8IL34
3 UniProt : Q3T0R6, F1MU22, L8IL34
3 Interpro : Q3T0R6, F1MU22, L8IL34
3 Prodom : Q3T0R6, F1MU22, L8IL34
3 Pfam : Q3T0R6, F1MU22, L8IL34
3 PIRSF : Q3T0R6, F1MU22, L8IL34
3 SUPERFAM : Q3T0R6, F1MU22, L8IL34
Sequence
Graphical view for this peptide sequence: bovin-q3t0r6
Colored MSA for Carb_B_Chordata (raw)
MKPDGPRLRLRAVAFGFLLLLVPGQGQDSTRPVRTTHTGKVQGSLVYVNN
ADVGVHTFLGIPFAKPPVGPLRFAPPEPPESWSGVKDGTSQPAKCPQDAD
GMKSMELWNVTLPSTSMSEDCLYLNIHTPAYSHEGSNLPVMVWIHGGGLV
LGMASMYDGSALAAFGDVVVVVIQYRLGLLGFFSTGDKHATGNWGYLDQV
AALRWVQQNIAYFGGDPGRVTIFGESAGGISVSLHVISPMSQGLFHGAIM
ESGVALLPGLTINSSDKVAKVVANLSACGQVDSEALVDCLRHKNEEEVLA
INKLVKIIPGVVDGIFLPKHPLELLASDDFQPVPSIIGVNNDEYGWIIPL
SVNNSDTRREISRESVRNALQELSTMTTMPPEFGELLMEEYIEDSEDHQT
LQNQLHEIMGDYLFVIPALQVAMFHRSHAPVYFYEFQHQSSFFKDVRPSS
VRADHGDEVLFLFRNEQIQFTEEEELLSRKMIKYWANFARNQNPNGEGLP
HWPMFDQEDQYMQLNTQPAVGRALKAHRLQFWMKTLPQKTQELMETKEKH
TEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKPDGPRLRLRAVAFGFLLLLVPGQGQDSTRPVRTTHTGKVQGSLVYVNN
ADVGVHTFLGIPFAKPPVGPLRFAPPEPPESWSGVKDGTSQPAKCPQDAD
GMKSMELWNVTLPSTSMSEDCLYLNIHTPAYSHEGSNLPVMVWIHGGGLV
LGMASMYDGSALAAFGDVVVVVIQYRLGLLGFFSTGDKHATGNWGYLDQV
AALRWVQQNIAYFGGDPGRVTIFGESAGGISVSLHVISPMSQGLFHGAIM
ESGVALLPGLTINSSDKVAKVVANLSACGQVDSEALVDCLRHKNEEEVLA
INKLVKIIPGVVDGIFLPKHPLELLASDDFQPVPSIIGVNNDEYGWIIPL
SVNNSDTRREISRESVRNALQELSTMTTMPPEFGELLMEEYIEDSEDHQT
LQNQLHEIMGDYLFVIPALQVAMFHRSHAPVYFYEFQHQSSFFKDVRPSS
VRADHGDEVLFLFRNEQIQFTEEEELLSRKMIKYWANFARNQNPNGEGLP
HWPMFDQEDQYMQLNTQPAVGRALKAHRLQFWMKTLPQKTQELMETKEKH
TEL


References
    Title: The yak genome and adaptation to life at high altitude
    Qiu Q, Zhang G, Ma T, Qian W, Wang J, Ye Z, Cao C, Hu Q, Kim J and Liu J <35 more author(s)>
    Ref: Nat Genet, 44:946, 2012 : PubMed

            

    Title: The genome sequence of taurine cattle: a window to ruminant biology and evolution
    Elsik CG, Tellam RL, Worley KC, Gibbs RA, Muzny DM, Weinstock GM, Adelson DL, Eichler EE, Elnitski L and Zhao FQ <297 more author(s)>
    Ref: Science, 324:522, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer