Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brael-e2rv62

Bradyrhizobium elkanii haloalkane dehalogenase (EC 3.8.1.5) DbeA

Relationship
Family|Haloalkane_dehalogenase-HLD2
Block| X
Position in NCBI Life Tree|Bradyrhizobium elkanii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Bradyrhizobiaceae: N E > Bradyrhizobium: N E > Bradyrhizobium elkanii: N E


Molecular evidence
Database
No mutation
3 structures: 4K2A, 6S42, 6XY9
No kinetic





No Substrate
No inhibitor
1 Genbank : BAJ23986
1 UniProt : E2RV62
3 Structure : 6S42, 6XY9, 4K2A
1 UniProt : E2RV62
1 Interpro : E2RV62
1 Prodom : E2RV62
1 Pfam : E2RV62
1 PIRSF : E2RV62
1 SUPERFAM : E2RV62
Sequence
Graphical view for this peptide sequence: brael-e2rv62
Colored MSA for Haloalkane_dehalogenase-HLD2 (raw)
MTISADISLHHRAVLGSTMAYRETGRSDAPHVLFLHGNPTSSYIWRNIMP
LVAPVGHCIAPDLIGYGQSGKPDISYRFFDQADYLDALIDELGIASAYLV
AQDWGTALAFHLAARRPQLVRGLAFMEFIRPMRDWSDFHQHDAARETFRK
FRTPGVGEAMILDNNAFVERVLPGSILRTLSEEEMAAYRAPFATRESRMP
TLMLPRELPIAGEPADVTQALTAAHAALAASTYPKLLFVGSPGALVSPAF
AAEFAKTLKHCAVIQLGAGGHYLQEDHPEAIGRSVAGWIAGIEAASAQRH
AACRAKRART
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTISADISLHHRAVLGSTMAYRETGRSDAPHVLFLHGNPTSSYIWRNIMP
LVAPVGHCIAPDLIGYGQSGKPDISYRFFDQADYLDALIDELGIASAYLV
AQDWGTALAFHLAARRPQLVRGLAFMEFIRPMRDWSDFHQHDAARETFRK
FRTPGVGEAMILDNNAFVERVLPGSILRTLSEEEMAAYRAPFATRESRMP
TLMLPRELPIAGEPADVTQALTAAHAALAASTYPKLLFVGSPGALVSPAF
AAEFAKTLKHCAVIQLGAGGHYLQEDHPEAIGRSVAGWIAGIEAASAQRH
AACRAKRART


References
2 more
    Title: Crystallization and Crystallographic Analysis of a Bradyrhizobium Elkanii USDA94 Haloalkane Dehalogenase Variant with an Eliminated Halide-Binding Site
    Prudnikova T, Kascakova B, Mesters JR, Grinkevich P, Havlickova P, Mazur A, Shaposhnikova A, Chaloupkova R, Damborsky J and Smatanova IK <1 more author(s)>
    Ref: , 9:375, 2019 : PubMed

            

    Title: Substrate specificity of haloalkane dehalogenases
    Koudelakova T, Chovancova E, Brezovsky J, Monincova M, Fortova A, Jarkovsky J, Damborsky J
    Ref: Biochemical Journal, 435:345, 2011 : PubMed

            

    Title: Crystallization and preliminary X-ray analysis of a novel haloalkane dehalogenase DbeA from Bradyrhizobium elkani USDA94
    Prudnikova T, Mozga T, Rezacova P, Chaloupkova R, Sato Y, Nagata Y, Brynda J, Kuty M, Damborsky J, Smatanova IK
    Ref: Acta Crystallographica Sect F Struct Biol Cryst Commun, 65:353, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer