Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brafl-ACHE1

Branchiostoma floridae (Florida lancelet) (Amphioxus) cholinesterase 1 (ChE1)

Comment
the two genes 272035 132597 are probably allelic


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Branchiostoma floridae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Cephalochordata: N E > Branchiostomidae: N E > Branchiostoma: N E > Branchiostoma floridae: N E


Molecular evidence
Database
1 mutation: brafl-ACHE1
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: AAD05373, XP_002588674, U74380
1 UniProt : C3ZRW7
2 Ncbi-nid : 3435077, 260787264
2 Ncbi-pid : 3435078, 260787265
2 UniProt : O76998, C3ZRW7
2 Interpro : O76998, C3ZRW7
2 Pfam : O76998, C3ZRW7
2 PIRSF : O76998, C3ZRW7
2 SUPERFAM : O76998, C3ZRW7
2 JGI Amphioxus gene : 272035, 132597
Sequence
Graphical view for this peptide sequence: brafl-ACHE1
Colored MSA for ACHE (raw)
MASRLLLQILPLLMLVRTSVDAATSVVQTSAGQVRGLELDVLGRKVNAFL
GIPFAKPPVGDLRFRAPEPADSWTLYDATQFPNSCVSAPDEAFPGFHGAE
MWNPNTPISEDCLYLNVWQPTPAPTGATVLVWIYGGGFFSGTSSLDVYDG
RYLARMEDVVVVSMNYRLGALGFLYSGSEAAPGNVGLLDQHLALLWVQQN
VHAFGGDPAKVTIFGESAGAASVNFHMISPMSRNLFQRAIMQSASALAPW
ALRPSEQARKRTKALAIDIGCSAEEEDMDALVACLRDVPAQTILDHEWNV
VDLTGAHFLADIPFPPIKDGSFLTEDPTEVYEKGTFKDIDILVGFVKNEG
NFWLVYGVPGFSKDTDSIIDRDTFVGDIEFCHPWLNDITVEATAFEYTDW
LHMDQDTMYRDALDSVFGDYFFVCPTTAVGKGHVNHGRTAYVYEFAQVAS
NLAWPHWMGAMHGYEIEFIFGLPIDPKWNYTAEEGELARRMMRYWTNFAR
TGNPNKRSPDDTTDDIWRPYTEEGREYIILDTDGTRMLNGPKSKQCAFWE
RYMPSLQKETDDLINDAEPCSSGGRSWRSEGVAKFSSLVAVFAVLTGHRL
QVFGH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASRLLLQILPLLMLVRTSVDAATSVVQTSAGQVRGLELDVLGRKVNAFL
GIPFAKPPVGDLRFRAPEPADSWTLYDATQFPNSCVSAPDEAFPGFHGAE
MWNPNTPISEDCLYLNVWQPTPAPTGATVLVWIYGGGFFSGTSSLDVYDG
RYLARMEDVVVVSMNYRLGALGFLYSGSEAAPGNVGLLDQHLALLWVQQN
VHAFGGDPAKVTIFGESAGAASVNFHMISPMSRNLFQRAIMQSASALAPW
ALRPSEQARKRTKALAIDIGCSAEEEDMDALVACLRDVPAQTILDHEWNV
VDLTGAHFLADIPFPPIKDGSFLTEDPTEVYEKGTFKDIDILVGFVKNEG
NFWLVYGVPGFSKDTDSIIDRDTFVGDIEFCHPWLNDITVEATAFEYTDW
LHMDQDTMYRDALDSVFGDYFFVCPTTAVGKGHVNHGRTAYVYEFAQVAS
NLAWPHWMGAMHGYEIEFIFGLPIDPKWNYTAEEGELARRMMRYWTNFAR
TGNPNKRSPDDTTDDIWRPYTEEGREYIILDTDGTRMLNGPKSKQCAFWE
RYMPSLQKETDDLINDAEPCSSGGRSWRSEGVAKFSSLVAVFAVLTGHRL
QVFGH


References
    Title: The amphioxus genome and the evolution of the chordate karyotype
    Putnam NH, Butts T, Ferrier DE, Furlong RF, Hellsten U, Kawashima T, Robinson-Rechavi M, Shoguchi E, Terry A and Rokhsar DS <27 more author(s)>
    Ref: Nature, 453:1064, 2008 : PubMed

            

    Title: cDNA cloning, in vitro expression, and biochemical characterization of cholinesterase 1 and cholinesterase 2 from amphioxus--comparison with cholinesterase 1 and cholinesterase 2 produced in vivo
    McClellan JS, Coblentz WB, Sapp M, Rulewicz G, Gaines DI, Hawkins A, Ozment C, Bearden A, Merritt S and Pezzementi L <3 more author(s)>
    Ref: European Journal of Biochemistry, 258:419, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer