Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: braja-dhaa

Bradyrhizobium japonicum; Bradyrhizobium diazoefficiens, haloalkane dehalogenase (EC 3.8.1.5) DhaA DbjA

Comment
Other strains: Bradyrhizobium japonicum; Bradyrhizobium diazoefficiens (JCM 10833 / IAM 13628 / NBR 14792 / USDA 110; SEMIA 5080)


Relationship
Family|Haloalkane_dehalogenase-HLD2
Block| X
Position in NCBI Life Tree|Bradyrhizobium japonicum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Bradyrhizobiaceae: N E > Bradyrhizobium: N E > Bradyrhizobium japonicum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
4 structures (e.g. : 3A2L, 3A2M, 3A2N... more)
No kinetic





30 substrates (e.g. : (Bromomethyl)cylcohexane, 1,2,3-Tribromopropane, 1,2,3-trichloropropane... more)
No inhibitor
>3 Genbank links 2 more: AP005939, NP_767727, NC_004463
1 UniProt : P59337
>3 Structure links 1 more: 3AFI, 3A2L, 3A2M
1 UniProt : P59337
1 Interpro : P59337
1 Pfam : P59337
1 PIRSF : P59337
1 SUPERFAM : P59337
Sequence
Graphical view for this peptide sequence: braja-dhaa
Colored MSA for Haloalkane_dehalogenase-HLD2 (raw)
MSKPIEIEIRRAPVLGSSMAYRETGAQDAPVVLFLHGNPTSSHIWRNILP
LVSPVAHCIAPDLIGFGQSGKPDIAYRFFDHVRYLDAFIEQRGVTSAYLV
AQDWGTALAFHLAARRPDFVRGLAFMEFIRPMPTWQDFHHTEVAEEQDHA
EAARAVFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGDEEMAPYRTP
FPTPESRRPVLAFPRELPIAGEPADVYEALQSAHAALAASSYPKLLFTGE
PGALVSPEFAERFAASLTRCALIRLGAGLHYLQEDHADAIGRSVAGWIAG
IEAVRPQLAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSKPIEIEIRRAPVLGSSMAYRETGAQDAPVVLFLHGNPTSSHIWRNILP
LVSPVAHCIAPDLIGFGQSGKPDIAYRFFDHVRYLDAFIEQRGVTSAYLV
AQDWGTALAFHLAARRPDFVRGLAFMEFIRPMPTWQDFHHTEVAEEQDHA
EAARAVFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGDEEMAPYRTP
FPTPESRRPVLAFPRELPIAGEPADVYEALQSAHAALAASSYPKLLFTGE
PGALVSPEFAERFAASLTRCALIRLGAGLHYLQEDHADAIGRSVAGWIAG
IEAVRPQLAA


References
    Title: Substrate specificity of haloalkane dehalogenases
    Koudelakova T, Chovancova E, Brezovsky J, Monincova M, Fortova A, Jarkovsky J, Damborsky J
    Ref: Biochemical Journal, 435:345, 2011 : PubMed

            

    Title: Enantioselectivity of haloalkane dehalogenases and its modulation by surface loop engineering
    Prokop Z, Sato Y, Brezovsky J, Mozga T, Chaloupkova R, Koudelakova T, Jerabek P, Stepankova V, Natsume R and Damborsky J <5 more author(s)>
    Ref: Angew Chem Int Ed Engl, 49:6111, 2010 : PubMed

            

    Title: Complete genomic sequence of nitrogen-fixing symbiotic bacterium Bradyrhizobium japonicum USDA110
    Kaneko T, Nakamura Y, Sato S, Minamisawa K, Uchiumi T, Sasamoto S, Watanabe A, Idesawa K, Iriguchi M and Tabata S <7 more author(s)>
    Ref: DNA Research, 9:189, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer