Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: braol-Q8GTM3

Brassica oleracea (Wild cabbage) (Cauliflower), Brassica rapa, chlorophyllase 2 (EC 3.1.1.14)

Comment
Other strains: Brassica oleracea (Wild cabbage) (Cauliflower) Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis) (Rape)


Relationship
Family|Chlorophyllase
Block| L
Position in NCBI Life Tree|Brassica oleracea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Brassiceae: N E > Brassica: N E > Brassica oleracea: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: braol-Q8GTM3
Colored MSA for Chlorophyllase (raw)
MSSSSSRNAFVDGKYKPDLLTVDLASRCRCYKTTPSSSLTPPPPPKSLLV
ATPVEEGEYPVVMLLHGYLLYNSFYSQLMLHVSSYGFIVIAPQLYNIAGP
DTIDEIKSTAEIIDWLSVGLNHFLPPQVTPNLSKFALTGHSRGGKTAFAV
ALKKFGYSSELKISAIIGVDPVDGTGKGKQTPPPVLTYEPNSFNLEKMPV
LVIGSGLGELARNPLFPPCAPTGVNHREFFQECQGPAWHFVAKDYGHLDM
LDDDTKGLRGKSSYCLCKNGEERKPMRRFIGGIVVSFLMAYLEDDDCELV
KIKAGCHEGVPVEIQEFEVKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSSSSSRNAFVDGKYKPDLLTVDLASRCRCYKTTPSSSLTPPPPPKSLLV
ATPVEEGEYPVVMLLHGYLLYNSFYSQLMLHVSSYGFIVIAPQLYNIAGP
DTIDEIKSTAEIIDWLSVGLNHFLPPQVTPNLSKFALTGHSRGGKTAFAV
ALKKFGYSSELKISAIIGVDPVDGTGKGKQTPPPVLTYEPNSFNLEKMPV
LVIGSGLGELARNPLFPPCAPTGVNHREFFQECQGPAWHFVAKDYGHLDM
LDDDTKGLRGKSSYCLCKNGEERKPMRRFIGGIVVSFLMAYLEDDDCELV
KIKAGCHEGVPVEIQEFEVKK


References
    Title: Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome
    Chalhoub B, Denoeud F, Liu S, Parkin IA, Tang H, Wang X, Chiquet J, Belcram H, Tong C and Wincker P <70 more author(s)>
    Ref: Science, 345:950, 2014 : PubMed

            

    Title: The genome of the mesopolyploid crop species Brassica rapa
    Wang X, Wang H, Wang J, Sun R, Wu J, Liu S, Bai Y, Mun JH, Bancroft I and Zhang Z <88 more author(s)>
    Ref: Nat Genet, 43:1035, 2011 : PubMed

            

    Title: Transgenic broccoli (Brassica oleracea var. italica) with antisense chlorophyllase (BoCLH1) delays postharvest yellowing.
    Chen LFO, Lin CH, Kelkar SM, Chang YM, Shaw JF
    Ref: Plant Sci, 174:25, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer