Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brarp-m4eey4

Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis). Lipase_3 domain-containing protein

Relationship
Family|Triacylglycerol-lipase-OBL1-like
Block| L
Position in NCBI Life Tree|Brassica rapa subsp. pekinensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Brassiceae: N E > Brassica: N E > Brassica rapa: N E > Brassica rapa subsp. pekinensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 UniProt : M4EEY4
1 UniProt : M4EEY4
1 Interpro : M4EEY4
1 Pfam : M4EEY4
1 PIRSF : M4EEY4
1 SUPERFAM : M4EEY4
Sequence
Graphical view for this peptide sequence: brarp-m4eey4
Colored MSA for Triacylglycerol-lipase-OBL1-like (raw)
MHQDNESNSGSNPGPGSNYLIVRPHRGGYKDLFQYGVRGDETSKNKFLER
PDDHSDRTTSVINVQADDRRWVIVVSILVRKIIGLLRTPMEYTGLVVDFV
LNLLSANGGLLGLVLGLIKAKVVIPERGSVDFVSTIGQLDGRIDLYKGWS
FVEQLVCMEDSVNSGSSGRVGIEPGSRGLVDLCVMASKLAYENAKVVENV
VNLHWKMNLVEFLDCWNDYQKQMSTQVFILTDKEKDADLILISFRGTEPF
DADDWGTDFDYSWYEIPNVGKLHMGFIEAMGLGTRDYTPTFHYHLVELNS
SEKENNQKNLPEMVERSAYYAVRETLKRLLAEHANAKFVVTGHSLGGALA
ILFPTLLVLKEETEMMKRLLGVYTFGQPRIGNREIGSFMKAKLNHPVDRY
FRVVYCNDLVPRLPYDDTTFLYKHFGVCLYYDSFYNETRAEDEPDPNPYG
MRYAVLAHVNAVWELVRGLIMGFIYGPGYREGWFRILFRLVGLTIPGLSD
HCPTDYVNSVRLGPDYDLQMSPL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHQDNESNSGSNPGPGSNYLIVRPHRGGYKDLFQYGVRGDETSKNKFLER
PDDHSDRTTSVINVQADDRRWVIVVSILVRKIIGLLRTPMEYTGLVVDFV
LNLLSANGGLLGLVLGLIKAKVVIPERGSVDFVSTIGQLDGRIDLYKGWS
FVEQLVCMEDSVNSGSSGRVGIEPGSRGLVDLCVMASKLAYENAKVVENV
VNLHWKMNLVEFLDCWNDYQKQMSTQVFILTDKEKDADLILISFRGTEPF
DADDWGTDFDYSWYEIPNVGKLHMGFIEAMGLGTRDYTPTFHYHLVELNS
SEKENNQKNLPEMVERSAYYAVRETLKRLLAEHANAKFVVTGHSLGGALA
ILFPTLLVLKEETEMMKRLLGVYTFGQPRIGNREIGSFMKAKLNHPVDRY
FRVVYCNDLVPRLPYDDTTFLYKHFGVCLYYDSFYNETRAEDEPDPNPYG
MRYAVLAHVNAVWELVRGLIMGFIYGPGYREGWFRILFRLVGLTIPGLSD
HCPTDYVNSVRLGPDYDLQMSPL


Reference
    Title: The genome of the mesopolyploid crop species Brassica rapa
    Wang X, Wang H, Wang J, Sun R, Wu J, Liu S, Bai Y, Mun JH, Bancroft I and Zhang Z <88 more author(s)>
    Ref: Nat Genet, 43:1035, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer