Gene_locus Report for: brasb-a5et73Bradyrhizobium sp. BTAi1 homoserine o-acetyltransferase like Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Bradyrhizobiaceae: N E > Bradyrhizobium: N E > Bradyrhizobium sp. BTAi1: N E
ABHD6-Lip : 9brad-q35a75Bradyrhizobium sp. BTAi1 probable lipase. AlphaBeta_hydrolase : 9brad-q35au9Bradyrhizobium sp. BTAi1 putative hydrolase precursor, 9brad-q35az3Bradyrhizobium sp. BTAi1 hypothetical protein, 9brad-q35bv0Bradyrhizobium sp. BTAi1 possible hydrolase, 9brad-q35e71Bradyrhizobium sp. BTAi1 probable hydrolase, 9brad-q35j98Bradyrhizobium sp. BTAi1 hydrolase, 9brad-q35r36Bradyrhizobium sp. BTAi1 putative hydrolase, 9brad-q354u0Bradyrhizobium sp. BTAi1 similar to dienelactone hydrolase and related enzymes precursor, 9brad-q356r9Bradyrhizobium sp. BTAi1 hypothetical protein. Atu1826-like : 9brad-q35ez6Bradyrhizobium sp.; Bradyrhizobium icense; Bradyrhizobium paxllaeri; Bradyrhizobium erythrophlei hypothetical protein. BD-FAE : 9brad-q35at5Bradyrhizobium sp. BTAi1 similar to esterase/lipase. Carboxypeptidase_S10 : brasb-a5elx3Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) hypothetical protein precursor. Chlorophyllase : 9brad-q35ig9Bradyrhizobium sp. BTAi1 hypothetical protein precursor. Dienelactone_hydrolase : 9brad-q35au3Bradyrhizobium sp. BTAi1 hypothetical protein precursor, 9brad-q35jr7Bradyrhizobium sp. BTAi1 hypothetical protein precursor, 9brad-q35ma4Bradyrhizobium sp. BTAi1 carboxymethylenebutenolidase (EC 3.1.1.45), 9brad-q35n34Bradyrhizobium sp. BTAi1 carboxymethylenebutenolidase (EC 3.1.1.45), 9brad-q356t0Bradyrhizobium sp. BTAi1 twin-arginine translocation pathway signal (EC 3.1.1.45), brasb-a5eck9Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) hypothetical protein, brasb-a5ek41Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) similar to dienelactone hydrolase and related enzymes precursor, brasb-a5ent6Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182), putative carboxymethylenebutenolidase, brasb-a5esb1Bradyrhizobium sp. BTAi1 carboxymethylenebutenolidase (EC 3.1.1.45), brasb-a5ese9Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) hypothetical protein. Est-OsmC : 9brad-q35qk2Bradyrhizobium sp. BTAi1 esterase is found in n-term of an OsmC/Ohr family domain. Esterase_phb : 9brad-q358e3Bradyrhizobium sp. BTAi1 polyhydroxybutyrate depolymerase precursor, 9brad-q358r1Bradyrhizobium sp. BTAi1 esterase, phb depolymerase. Hormone-sensitive_lipase_like : 9brad-q35dm4Bradyrhizobium sp. BTAi1 putative esterase/lipase precursor, 9brad-q35jz4Bradyrhizobium sp. (BTAi1 / ATCC BAA-1182) putative lipase/esterase, 9brad-q35nq2Bradyrhizobium sp. BTAi1 putative steroid monooxygenase. Lipase_3 : 9brad-q356a5Bradyrhizobium sp. BTAi1 hypothetical protein. LYsophospholipase_carboxylesterase : 9brad-q35pp2Bradyrhizobium sp. BTAi1 hypothetical protein, 9brad-q35rs3Bradyrhizobium sp. BTAi1 hypothetical protein. Monoglyceridelipase_lysophospholip : 9brad-q35pq5Bradyrhizobium sp. BTAi1 hypothetical protein. PhaC_cen_dom : 9brad-q35fu4Bradyrhizobium sp. BTAi1 probable poly-beta-hydroxybutyrate polymerase, 9brad-q355g0Bradyrhizobium sp. BTAi1 poly(3-hydroxyalkanoate) polymerase family protein, brasb-a5esl7Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) poly-beta-hydroxybutyrate polymerase. PHA_synth_I : 9brad-q35ew8Bradyrhizobium sp. BTAi1 poly(r)-hydroxyalkanoic acid synthase, class i. PHB_depolymerase_PhaZ : brasb-a5epv4Bradyrhizobium sp. polyhydroxyalkanoate depolymerase, brasb-a5etk7Bradyrhizobium sp., polyhydroxyalkanoate depolymerase. S9N_PPCE_Peptidase_S9 : brasb-a5e9x2Bradyrhizobium sp. probable peptidase. S9N_PREPL_Peptidase_S9 : brasb-a5e9h9Bradyrhizobium sp. BTAi1 oligopeptidase b (EC 3.4.21.83). Tannase : 9brad-q35q52Bradyrhizobium sp. BTAi1 hypothetical protein, 9brad-q358f9Bradyrhizobium sp. BTAi1 hypothetical protein precursor, 9brad-q358x9Bradyrhizobium sp. BTAi1 chlorogenate esterase precursor. Thioesterase : 9brad-q35dm5Bradyrhizobium sp. BTAi1 amino acid adenylation, 9brad-q35dm8Bradyrhizobium sp. BTAi1 thioesterase, 9brad-q35nz8Bradyrhizobium sp. BTAi1 probable thioesterase, 9brad-q35qw4Bradyrhizobium sp. BTAi1 non-ribosomal peptide synthase:amino acid adenylation, 9brad-q359s8Bradyrhizobium sp. BTAi1 amino acid adenylation
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: brasb-a5et73 Colored MSA for Homoserine_transacetylase_like_est (raw)
MTSVADYQIFEAGDVVLQSGATVPSLRLAYKTYGTLNAAKDNVILYPTSF
SAQHVDTEWLVGPADILDSDRYFIIIPNLFGNGLSSSPSNTPPADAPFPA
ISYHDAVAIQRRLVEEQFGITRIALVYGWSMGGMQAYHWAACHPDMVERA
AVVCGSARCSPYNHVFLDAVKAALIADPAYKNGRFVAKPVAGLRAMGRIY
AGWAMSYEFYRDEVWREQGFAAQEDYLAATWDTAFAHRDANNLLAQIAIW
QNGDISHCSAFGGDLDRALSAITAHMLLMPGQTDRYFDWRDNERELPKLV
NASSAVLRPIPSIHGHRAGNPIRIPADRDFIKANILTLLQS
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MTSVADYQIFEAGDVVLQSGATVPSLRLAYKTYGTLNAAKDNVILYPTSF SAQHVDTEWLVGPADILDSDRYFIIIPNLFGNGLSSSPSNTPPADAPFPA ISYHDAVAIQRRLVEEQFGITRIALVYGWSMGGMQAYHWAACHPDMVERA AVVCGSARCSPYNHVFLDAVKAALIADPAYKNGRFVAKPVAGLRAMGRIY AGWAMSYEFYRDEVWREQGFAAQEDYLAATWDTAFAHRDANNLLAQIAIW QNGDISHCSAFGGDLDRALSAITAHMLLMPGQTDRYFDWRDNERELPKLV NASSAVLRPIPSIHGHRAGNPIRIPADRDFIKANILTLLQS
|
|
|