Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bruma-a8qgj6

Brugia malayi (Filarial nematode worm) Prolyl oligopeptidase family protein

Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Brugia malayi
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Nematoda: N E > Chromadorea: N E > Spirurida: N E > Filarioidea: N E > Onchocercidae: N E > Brugia: N E > Brugia malayi: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : DS239691, XP_001902530
1 UniProt : A0A0J9XS93
1 Interpro : A0A0J9XS93
1 Prodom : A0A0J9XS93
1 Pfam : A0A0J9XS93
1 PIRSF : A0A0J9XS93
1 SUPERFAM : A0A0J9XS93
Sequence
Graphical view for this peptide sequence: bruma-a8qgj6
Colored MSA for DPP4N_Peptidase_S9 (raw)
MNKLTKQLLLVCKFTIPGCSPARPMKYPVAGTANAVSTLRLIVIDGNKIT
DEKLAVELKTVYPWYEYLARVGWLSDGSAIWALLLSRLQDRYALVLIPLN
LFGSRDNQSSAQVVTLLQEQSEIWFNVDNLTRFLTPVGGILQFIHASDRD
DYTHLFHYTAKLDEAHVTATCSSRPVTAGDWSVLKEPGLFVDEKRKHVYF
VANKHHPSDSNLYERMECELQLNPEIGFVCWESSLQMPPRCVFYRLHHLN
GDRLPTATLQHFIYLPQQSLANELSQRIENICVPKVAVKDYPELIEYQSE
NSKRKHYALLLKPFGAIRGLQYPVIQLVYGGPGVQLVRNAWSTWVGFRKF
ASLGYAVLMVDGRGSSNRGISFEAALKNKLGTVEIEDQVEGLREVAKRTG
GLLDLTRVAIMGWSYGGYLALLCLAKNPNVYRAAIAGGAVTCWRLYDTAY
TERYLGLPSDPIYKDSSVLSYVNQLPNEVDRLLIVHGLIDENVHFSHTER
LIEALIAAGKPHRLQIFPSERHGVRSVEAGEFHDASMLSFLCRALAVDRI
HSDITKNTDKSF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNKLTKQLLLVCKFTIPGCSPARPMKYPVAGTANAVSTLRLIVIDGNKIT
DEKLAVELKTVYPWYEYLARVGWLSDGSAIWALLLSRLQDRYALVLIPLN
LFGSRDNQSSAQVVTLLQEQSEIWFNVDNLTRFLTPVGGILQFIHASDRD
DYTHLFHYTAKLDEAHVTATCSSRPVTAGDWSVLKEPGLFVDEKRKHVYF
VANKHHPSDSNLYERMECELQLNPEIGFVCWESSLQMPPRCVFYRLHHLN
GDRLPTATLQHFIYLPQQSLANELSQRIENICVPKVAVKDYPELIEYQSE
NSKRKHYALLLKPFGAIRGLQYPVIQLVYGGPGVQLVRNAWSTWVGFRKF
ASLGYAVLMVDGRGSSNRGISFEAALKNKLGTVEIEDQVEGLREVAKRTG
GLLDLTRVAIMGWSYGGYLALLCLAKNPNVYRAAIAGGAVTCWRLYDTAY
TERYLGLPSDPIYKDSSVLSYVNQLPNEVDRLLIVHGLIDENVHFSHTER
LIEALIAAGKPHRLQIFPSERHGVRSVEAGEFHDASMLSFLCRALAVDRI
HSDITKNTDKSF


Reference
    Title: Draft genome of the filarial nematode parasite Brugia malayi
    Ghedin E, Wang S, Spiro D, Caler E, Zhao Q, Crabtree J, Allen JE, Delcher AL, Guiliano DB and Scott AL <61 more author(s)>
    Ref: Science, 317:1756, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer