Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brume-BMEII0989

Brucella melitensis; Brucella abortus; Brucella suis; B. pinnipedialis; B. ceti; B. neotomae; B. ovis; B. microti; B. inopinata; B. canis hypothetical protein bmeII0989

Comment
Brucella melitensis (M5-90; M28; biovar 1 (Rev.1; 16M / ATCC 23456 / NCTC 10094), 2 (ATCC 23457; 63/9) 3 Ether); Brucella suis (ATCC 23445 / NCTC 10510; ATCC 23445 / NCTC 10510; biovars: 1 (1330) 4 (40), 3 (686), 5 (513)); Brucella pinnipedialis (M292/94/1; B2/94; M163/99/10); Brucella ceti (M13/05/1; B1/94; M644/93/1; M490/95/1; Cudo); Brucella abortus (biovars: 9 (C68), 3 (Tulya); 5 (B3196), 6 (870)); Brucella sp. (F5/99; NVSL 07-0026; 83/13; NF 2653; BO2); Brucella neotomae 5K33; Brucella ovis (ATCC 25840 / 63/290 / NCTC 10512); Brucella microti (CCM 4915); Brucella inopinata BO1; Brucella canis (ATCC 23365 / NCTC 10854)


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Brucella melitensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Brucellaceae: N E > Brucella: N E > Brucella melitensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: brume-BMEII0989
Colored MSA for Thioesterase (raw)
MGLLAGAALVLPSLPAEAKTQQAAMPPNATSPHQADVYLLRGFADIFSTG
IDEIGAELQAAGVNAHVQGHAAWRLVLNRIVADQQKNGHLPVVLIGHSLG
ANAAIYIAEELERRGIAVDYMATFAATGPDPLPGNVRRVVNFYFKQHGWG
LPLVPGPRFHGHLENRDFSNAKDVGHFNIEKQRPLQAEVVRDVLAVVNAD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGLLAGAALVLPSLPAEAKTQQAAMPPNATSPHQADVYLLRGFADIFSTG
IDEIGAELQAAGVNAHVQGHAAWRLVLNRIVADQQKNGHLPVVLIGHSLG
ANAAIYIAEELERRGIAVDYMATFAATGPDPLPGNVRRVVNFYFKQHGWG
LPLVPGPRFHGHLENRDFSNAKDVGHFNIEKQRPLQAEVVRDVLAVVNAD


References
2 more
    Title: The genome sequence of Brucella pinnipedialis B2/94 sheds light on the evolutionary history of the genus Brucella
    Audic S, Lescot M, Claverie JM, Cloeckaert A, Zygmunt MS
    Ref: BMC Evol Biol, 11:200, 2011 : PubMed

            

    Title: The genome sequence of the facultative intracellular pathogen Brucella melitensis
    DelVecchio VG, Kapatral V, Redkar RJ, Patra G, Mujer C, Los T, Ivanova N, Anderson I, Bhattacharyya A and Overbeek R <15 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:443, 2002 : PubMed

            

    Title: The Brucella suis genome reveals fundamental similarities between animal and plant pathogens and symbionts
    Paulsen IT, Seshadri R, Nelson KE, Eisen JA, Heidelberg JF, Read TD, Dodson RJ, Umayam L, Brinkac LM and Fraser CM <21 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:13148, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer