Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: burch-a0az59

Burkholderia cenocepacia Cif-like epoxide hydrolase Bcen_4419 Clf2

Comment
Other strains: Burkholderia cenocepacia (strains HI2424; AU 1054; PC184; MC0-3)


Relationship
Family|CFTR-inhibitory-factor_Cif
Block| X
Position in NCBI Life Tree|Burkholderia cenocepacia
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > Burkholderia cepacia complex: N E > Burkholderia cenocepacia: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
7JQZ: Crystal structure of Cif-Like Epoxide Hydrolase Cfl2 Wild type from Burkholderia cenocepacia
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: CP000459, CP000379, CH482378
3 UniProt : A2VZQ5, B1K378, A0A0H2XWA8
1 Structure : 7JQZ
3 UniProt : A2VZQ5, B1K378, A0A0H2XWA8
3 Interpro : A2VZQ5, B1K378, A0A0H2XWA8
3 Prodom : A2VZQ5, B1K378, A0A0H2XWA8
3 Pfam : A2VZQ5, B1K378, A0A0H2XWA8
3 PIRSF : A2VZQ5, B1K378, A0A0H2XWA8
3 SUPERFAM : A2VZQ5, B1K378, A0A0H2XWA8
Sequence
Graphical view for this peptide sequence: burch-a0az59
Colored MSA for CFTR-inhibitory-factor_Cif (raw)
MYQHQSTEAASHLEATPYFREDPRLTGFRHRFDTVDGVRLHFVEGGRADG
ETIVLLAGFPESWYAWRRVMPLLADEFRIVAPDLPGQGDSDRPLVGYDTQ
TVAATLARLLERQNIARFYLAAHDVGAWVAYPFAAMYPESVKRLALLDAG
IPGVTLPAALPIEPGNAWRTWHFAFHTVADLPETLIAGKEREYLDWFLRR
KAANPESFSDADVDEYLRVFTRDGGLRAGLAFYRAVSESSAQNRKLQALG
KLKMPVLAVSADQGSIPDMAGPLEHVAEEVTAATIAYSGHFIPEEQPQAL
ARELRDFFR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYQHQSTEAASHLEATPYFREDPRLTGFRHRFDTVDGVRLHFVEGGRADG
ETIVLLAGFPESWYAWRRVMPLLADEFRIVAPDLPGQGDSDRPLVGYDTQ
TVAATLARLLERQNIARFYLAAHDVGAWVAYPFAAMYPESVKRLALLDAG
IPGVTLPAALPIEPGNAWRTWHFAFHTVADLPETLIAGKEREYLDWFLRR
KAANPESFSDADVDEYLRVFTRDGGLRAGLAFYRAVSESSAQNRKLQALG
KLKMPVLAVSADQGSIPDMAGPLEHVAEEVTAATIAYSGHFIPEEQPQAL
ARELRDFFR


Reference
    Title: Biochemical and Structural Characterization of Two Cif-Like Epoxide Hydrolases from Burkholderia cenocepacia
    Taher NM, Hvorecny KL, Burke CM, Gilman MSA, Heussler GE, Adolf-Bryfogle J, Bahl CD, O'Tool GA, Madden DR
    Ref: Current Research in Structural Biology, 3:72, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer