Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: burch-a0b0f8

Burkholderia cenocepacia; Burkholderia cepacia Cif-Like Epoxide Hydrolase Bcen_3967 Cfl1

Comment
Other strains: Burkholderia cenocepacia (strains HI2424; AU 1054; J2315); Burkholderia cepacia (strain J2315 / LMG 16656). The reference here is the sequence of the strain J2315 which has been structuraly and biochemicaly characterized by Taher et al.


Relationship
Family|CFTR-inhibitory-factor_Cif
Block| X
Position in NCBI Life Tree|Burkholderia cenocepacia
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > Burkholderia cepacia complex: N E > Burkholderia cenocepacia: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 7JQX, 7JQY
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: CAR55383, CP000459, CP000379
2 UniProt : B4EJL9, A0A0H2XV29
2 Structure : 7JQX, 7JQY
2 UniProt : A0A0H2XV29, B4EJL9
2 Interpro : A0A0H2XV29, B4EJL9
2 Prodom : A0A0H2XV29, B4EJL9
2 Pfam : A0A0H2XV29, B4EJL9
2 PIRSF : A0A0H2XV29, B4EJL9
2 SUPERFAM : A0A0H2XV29, B4EJL9
Sequence
Graphical view for this peptide sequence: burch-a0b0f8
Colored MSA for CFTR-inhibitory-factor_Cif (raw)
MQNERSEQSMPGMPAPGLPAGFERRFSRRYAQLDDVRLHYVTGGPDDGEM
VVLLHGWPQTWYTWRHVMPALAEDGYRVVAVDYRGAGESDKPLGGYDKAS
MAGDIRALVHQLGATRIHLVGRDIGVMVAYAYAAQWPTEIVKLAMLDVPV
PGTRIWDEAKASADPQIWHFGLHQQRDIAEMLIAGKERAYILDFYKKRTH
VALSNDDIAVYADAYAAPGALRAGFELYRAFPQDETRFKAFMKHKLPMPV
LALAGDKSNGAKELDMARELALDVRGAVAPNTGHWLPDENPAFLTRQLLD
FFREAASGR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQNERSEQSMPGMPAPGLPAGFERRFSRRYAQLDDVRLHYVTGGPDDGEM
VVLLHGWPQTWYTWRHVMPALAEDGYRVVAVDYRGAGESDKPLGGYDKAS
MAGDIRALVHQLGATRIHLVGRDIGVMVAYAYAAQWPTEIVKLAMLDVPV
PGTRIWDEAKASADPQIWHFGLHQQRDIAEMLIAGKERAYILDFYKKRTH
VALSNDDIAVYADAYAAPGALRAGFELYRAFPQDETRFKAFMKHKLPMPV
LALAGDKSNGAKELDMARELALDVRGAVAPNTGHWLPDENPAFLTRQLLD
FFREAASGR


Reference
    Title: Biochemical and Structural Characterization of Two Cif-Like Epoxide Hydrolases from Burkholderia cenocepacia
    Taher NM, Hvorecny KL, Burke CM, Gilman MSA, Heussler GE, Adolf-Bryfogle J, Bahl CD, O'Tool GA, Madden DR
    Ref: Current Research in Structural Biology, 3:72, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer