Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: burcj-b4e794

Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) (Burkholderia cepacia (strain J2315)). Putative hydrolase

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Burkholderia cenocepacia
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > Burkholderia cepacia complex: N E > Burkholderia cenocepacia: N E


Molecular evidence
Database
No mutation
1 structure:
4X00: X-ray crystal structure of a putative aryl esterase from Burkholderia cenocepacia
No kinetic





No Substrate
No inhibitor
1 Genbank : AM747720
1 UniProt : B4E794
1 Structure : 4X00
1 UniProt : B4E794
1 Interpro : B4E794
1 Prodom : B4E794
1 Pfam : B4E794
1 PIRSF : B4E794
1 SUPERFAM : B4E794
Sequence
Graphical view for this peptide sequence: burcj-b4e794
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MSLSKLRGALGALIATFALLAAAPATFAAARDYTVTAPDGVVLAVQEAGD
PEGSPIIFIHGLLGSRLNWSKQLQDPRLQHYRLITYDLRGHGLSGKPAEA
SSYTDGRRWADDLAAIIESTHARKPVLVGWSLGGAVISNYLAAYGDKGIA
GAVYVDGVIELKPDQIVAHPEVYRDMIASDLQTHLDGERAFLRLCFHRQP
DATTFSLLLANAALASWDMQRAVRSMTVEAAKGLSKAEVPLLLLYGAQDA
LVKAKPSIARAKSLNPRIRSELYADSGHAPFLEEPERFNRDLSDFVRMAL
SR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSLSKLRGALGALIATFALLAAAPATFAAARDYTVTAPDGVVLAVQEAGD
PEGSPIIFIHGLLGSRLNWSKQLQDPRLQHYRLITYDLRGHGLSGKPAEA
SSYTDGRRWADDLAAIIESTHARKPVLVGWSLGGAVISNYLAAYGDKGIA
GAVYVDGVIELKPDQIVAHPEVYRDMIASDLQTHLDGERAFLRLCFHRQP
DATTFSLLLANAALASWDMQRAVRSMTVEAAKGLSKAEVPLLLLYGAQDA
LVKAKPSIARAKSLNPRIRSELYADSGHAPFLEEPERFNRDLSDFVRMAL
SR


Reference
    Title: The genome of Burkholderia cenocepacia J2315, an epidemic pathogen of cystic fibrosis patients
    Holden MT, Seth-Smith HM, Crossman LC, Sebaihia M, Bentley SD, Cerdeno-Tarraga AM, Thomson NR, Bason N, Quail MA and Parkhill J <22 more author(s)>
    Ref: Journal of Bacteriology, 191:261, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer