Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: burgl-EstC

Burkholderia gladioli EstC (estC) gene, complete cds

Relationship
Family|HNLyase_Bact
Block| X
Position in NCBI Life Tree|Burkholderia gladioli
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > Burkholderia gladioli: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
1 Genbank : AF144381
1 Ncbi-nid : 7672984
1 Ncbi-pid : 7672985
1 UniProt : Q9LAB8
1 Interpro : Q9LAB8
1 Prodom : Q9LAB8
1 Pfam : Q9LAB8
1 PIRSF : Q9LAB8
1 SUPERFAM : Q9LAB8
Sequence
Graphical view for this peptide sequence: burgl-EstC
Colored MSA for HNLyase_Bact (raw)
MNHPDIDTHSRNAAAPLPFVLVHGAWHGAWAYERLGAALAARGHASVAHD
LPAHGINARYPAAFWQGDAQALAQEPSPVAATTLDDYTGQVLRAIDAACA
LGHPRVVLVGHSMGGVAITAAAERAPERIAALVYLAAFMPASGVPGLDYV
RAPENHGEMLASLICASPRAIGALRINPASRDAAYLATLKQALFEDVDEA
TFRAVTRLMSSDVPTAPFATPIATTAERWGSIARHYVTCAEDRVILPALQ
RRFIAEADAFLPERPTRVHALDSSHSPFLSQPDTLAELLTGIARNTAI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNHPDIDTHSRNAAAPLPFVLVHGAWHGAWAYERLGAALAARGHASVAHD
LPAHGINARYPAAFWQGDAQALAQEPSPVAATTLDDYTGQVLRAIDAACA
LGHPRVVLVGHSMGGVAITAAAERAPERIAALVYLAAFMPASGVPGLDYV
RAPENHGEMLASLICASPRAIGALRINPASRDAAYLATLKQALFEDVDEA
TFRAVTRLMSSDVPTAPFATPIATTAERWGSIARHYVTCAEDRVILPALQ
RRFIAEADAFLPERPTRVHALDSSHSPFLSQPDTLAELLTGIARNTAI


Reference
    Title: Cloning and characterization of EstC from Burkholderia gladioli, a novel-type esterase related to plant enzymes
    Reiter B, Glieder A, Talker D, Schwab H
    Ref: Applied Microbiology & Biotechnology, 54:778, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer