Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: burgs-f2la46

Burkholderia gladioli (Pseudomonas marginata). Virulence factor

Comment
Other strains: Burkholderia gladioli (Pseudomonas marginata) (strain BSR3)


Relationship
Family|VirJ
Block| X
Position in NCBI Life Tree|Burkholderia gladioli
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > Burkholderia gladioli: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CP002599, WP_046580066, WP_060003890
1 UniProt : F2LA46
1 UniProt : F2LA46
1 Interpro : F2LA46
1 Pfam : F2LA46
1 PIRSF : F2LA46
1 SUPERFAM : F2LA46
Sequence
Graphical view for this peptide sequence: burgs-f2la46
Colored MSA for VirJ (raw)
MKWNGWGRAAVAAGMMLVQVAGAGAAESGKAGGKLADKATAASAASQPVT
LVGRMGRMPGGRYGEVSVVRPEGDVHGFVVLYSAAGGWSAADQVTAEALA
KAGALTVGVDTARYAANLARDKESCHQLVGDAEAVSHQLERQLKTSRYFA
PIVAGIGQGGALARQVLAQAPENTISGAVTVAPAATLDARFRMCPPDPTV
SRRKTPGFVDSAATGDAARLVSLLAPHLRDGSADELDVSDLPLVELPARP
GGMAAGEGLLAIVISGDGGWRDLDKTIAEALQKDGVSVVGWDSLRYFWSE
KTPAQTSHDLARVMQTYLARWHASHVALIGYSFGADVMPFAYNRLAQPLK
DKVSVISLLGFAPSADFQIRVTGWLGMPASDQALQVRPEFNKLPLKQVQC
FYGATEQDTLCPALAGSGAQVIKTGGDHHFGGDYLALERQILDALRRNAA
GR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKWNGWGRAAVAAGMMLVQVAGAGAAESGKAGGKLADKATAASAASQPVT
LVGRMGRMPGGRYGEVSVVRPEGDVHGFVVLYSAAGGWSAADQVTAEALA
KAGALTVGVDTARYAANLARDKESCHQLVGDAEAVSHQLERQLKTSRYFA
PIVAGIGQGGALARQVLAQAPENTISGAVTVAPAATLDARFRMCPPDPTV
SRRKTPGFVDSAATGDAARLVSLLAPHLRDGSADELDVSDLPLVELPARP
GGMAAGEGLLAIVISGDGGWRDLDKTIAEALQKDGVSVVGWDSLRYFWSE
KTPAQTSHDLARVMQTYLARWHASHVALIGYSFGADVMPFAYNRLAQPLK
DKVSVISLLGFAPSADFQIRVTGWLGMPASDQALQVRPEFNKLPLKQVQC
FYGATEQDTLCPALAGSGAQVIKTGGDHHFGGDYLALERQILDALRRNAA
GR


Reference
    Title: Complete genome sequence of Burkholderia gladioli BSR3
    Seo YS, Lim J, Choi BS, Kim H, Goo E, Lee B, Lim JS, Choi IY, Moon JS and Hwang I <1 more author(s)>
    Ref: Journal of Bacteriology, 193:3149, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer