Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: burxl-bphD

Burkholderia xenovorans 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase gene bphD

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Burkholderia xenovorans LB400
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Paraburkholderia: N E > Paraburkholderia xenovorans: N E > Paraburkholderia xenovorans LB400: N E


Molecular evidence
Database
No mutation
12 structures (e.g. : 2OG1, 2PU5, 2PU7... more)
No kinetic





3 substrates: HOPDA, HOPDA-3,10-DiF, HOPDA-3-Cl
No inhibitor
1 Genbank : X66123
1 UniProt : P47229
1 Ncbi-nid : 397885
1 Ncbi-pid : 397886
>3 Structure links 9 more: 3V1K, 3V1L, 3V1M
1 UniProt : P47229
1 Interpro : P47229
1 Prodom : P47229
1 Pfam : P47229
1 PIRSF : P47229
1 SUPERFAM : P47229
Sequence
Graphical view for this peptide sequence: burxl-bphD
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MTALTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWS
NYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDA
LDIDRAHLVGNSMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPM
EGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEH
LKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLW
NIDDARLHVFSKCGHWAQWEHADEFNRLVIDFLRHA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTALTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWS
NYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDA
LDIDRAHLVGNSMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPM
EGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEH
LKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLW
NIDDARLHVFSKCGHWAQWEHADEFNRLVIDFLRHA


References
5 more
    Title: Kinetic and structural insight into the mechanism of BphD, a C-C bond hydrolase from the biphenyl degradation pathway
    Horsman GP, Ke J, Dai S, Seah SY, Bolin JT, Eltis LD
    Ref: Biochemistry, 45:11071, 2006 : PubMed

            

    Title: Identification of a serine hydrolase as a key determinant in the microbial degradation of polychlorinated biphenyls
    Seah SY, Labbe G, Nerdinger S, Johnson MR, Snieckus V, Eltis LD
    Ref: Journal of Biological Chemistry, 275:15701, 2000 : PubMed

            

    Title: Genetic analysis of a Pseudomonas locus encoding a pathway for biphenyl/polychlorinated biphenyl degradation
    Hofer B, Eltis LD, Dowling DN, Timmis KN
    Ref: Gene, 130:47, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer