caeel-NLGN1

 
Caenorhabditis elegans Neuroligin C40C9.5a gene Y12A6A.a

Comment
Neuroligins function as ligands for the neurexin family and MADD-4. This interaction is necessary for GABA receptors clustering.


Relationship
Family Neuroligin
Block C
Caenorhabditis elegans position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Nematoda: N E > Chromadorea: N E > Rhabditida: N E > Rhabditoidea: N E > Rhabditidae: N E > Peloderinae: N E > Caenorhabditis: N E > Caenorhabditis elegans: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 4 more: AL023827, Z70266, FJ825295
>3 UniProt links 2 more: Q9XTG1, C1KGB4, G5EED7
1 Ncbi-pid : 3217813
>3 UniProtTrembl links 7 more: Q9XTG1, C1KGB4, G5EED7
>3 Interpro links 7 more: Q9XTG1, C1KGB4, G5EED7
>3 Prodom links 7 more: Q9XTG1, C1KGB4, G5EED7
>3 Pfam links 7 more: Q9XTG1, C1KGB4, G5EED7
>3 PIRSF links 7 more: Q9XTG1, C1KGB4, G5EED7
>3 SUPERFAM links 7 more: Q9XTG1, C1KGB4, G5EED7
>3 QuickSwissBlast links 7 more: Q9XTG1, C1KGB4, G5EED7
1 WormBase : C40C9.5
1 WormBase Cosmid : C40C9

 
Sequence
Graphical view for this peptide sequence: caeel-NLGN1
Colored MSA for Neuroligin (raw)
MERIYLLLLLFLPRIRSYDVRSVTTSWGMVRGEVVSPEGDDLPPVAQYLG
IPYGVAPTGQYRFNMAISAAKWTHMPKDARKVSPVCIQTDMPELSETKRF
RAFKHTSAQRFDFNHRLLPHLKKQSEDCLYMNIYVPERLEISRDNYLPVM
VIVHGEEYGWGTGNAFNGTTLAAYGHIIVVTLNYRLGVFGFLGRCESSSC
SGNSGISDLVSALTMLNVILPSFGGDSKSVTLAGWGSGASLVSLLMASPL
TQPGRRLFRRAILLDGSALSPWAISQNPQQYFMQLAEELACAPKNRTSSF
NDNVDTIVRCMQVHSSENITKAVLKIDVPTFLSGFAPIVDGQLIPNKPQV
SFSTQYGSLFREIDLLVGISSNPSHHMISNEDLKVGISKEKRMRIFRSLV
RNLYDFHREEILASIINEYTDWENPRDHPKSIRNGVLNALSDVLYTAPLI
ETLRSHSADEVRKEANTFMFAFAHETRSWSQEQPNSGIRGSLSGDIVPYI
FGYPLAQGDSEERLYSGFNTDDKGISKVMMHYVSNFVKSGDPSKPNPMSK
NFPMGDVFHSTAWPQFDQPNREAYLEITDRPRVKNYYRNAQVGFWNNFIP
QLHKNGKETEPVGEEHHLLSDHFRKDSYFGKTRHFSSYANLPFPPPPMPP
SPPPELTTKPKPSESPTTLQTTTESEKAAAGSFTGKALGGVIFIGCGFLI
MNVCLLIAVRREWGKKRRNEKKFQLQYQTYNSNHGGGAEQYNSLNSPLSL
MPPPPPPLNGVHDDIFDHRVPHLRNGSTVHGTLPRHSFQEQEPLLSASHK
NSTSMRPAGISPTCPRHGRAALALQNSRGNSLTAAQAPTLEEIQV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MERIYLLLLLFLPRIRSYDVRSVTTSWGMVRGEVVSPEGDDLPPVAQYLG
IPYGVAPTGQYRFNMAISAAKWTHMPKDARKVSPVCIQTDMPELSETKRF
RAFKHTSAQRFDFNHRLLPHLKKQSEDCLYMNIYVPERLEISRDNYLPVM
VIVHGEEYGWGTGNAFNGTTLAAYGHIIVVTLNYRLGVFGFLGRCESSSC
SGNSGISDLVSALTMLNVILPSFGGDSKSVTLAGWGSGASLVSLLMASPL
TQPGRRLFRRAILLDGSALSPWAISQNPQQYFMQLAEELACAPKNRTSSF
NDNVDTIVRCMQVHSSENITKAVLKIDVPTFLSGFAPIVDGQLIPNKPQV
SFSTQYGSLFREIDLLVGISSNPSHHMISNEDLKVGISKEKRMRIFRSLV
RNLYDFHREEILASIINEYTDWENPRDHPKSIRNGVLNALSDVLYTAPLI
ETLRSHSADEVRKEANTFMFAFAHETRSWSQEQPNSGIRGSLSGDIVPYI
FGYPLAQGDSEERLYSGFNTDDKGISKVMMHYVSNFVKSGDPSKPNPMSK
NFPMGDVFHSTAWPQFDQPNREAYLEITDRPRVKNYYRNAQVGFWNNFIP
QLHKNGKETEPVGEEHHLLSDHFRKDSYFGKTRHFSSYANLPFPPPPMPP
SPPPELTTKPKPSESPTTLQTTTESEKAAAGSFTGKALGGVIFIGCGFLI
MNVCLLIAVRREWGKKRRNEKKFQLQYQTYNSNHGGGAEQYNSLNSPLSL
MPPPPPPLNGVHDDIFDHRVPHLRNGSTVHGTLPRHSFQEQEPLLSASHK
NSTSMRPAGISPTCPRHGRAALALQNSRGNSLTAAQAPTLEEIQV

no DNA




References
5 more
    Title: Graphene oxide disrupts the protein-protein interaction between Neuroligin/NLG-1 and DLG-1 or MAGI-1 in nematode Caenorhabditis elegans
    Zhao Y, Chen H, Yang Y, Wu Q, Wang D
    Ref: Sci Total Environ, 700:134492, 2019 : PubMed

            

    Title: Analysis of splice variants for the C. elegans orthologue of human neuroligin reveals a developmentally regulated transcript
    Calahorro F, Holden-Dye L, O'Connor V
    Ref: Gene Expr Patterns, 17:69, 2015 : PubMed

            

    Title: Genome sequence of the nematode C. elegans: a platform for investigating biology. The C. elegans Sequencing Consortium
    CEGSC
    Ref: Science, 282:2012, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer