Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: calro-ACHE1B

Caligus rogercresseyi (Sea louse). Acetylcholinesterase 1B

Comment
calro-ACHE1B was classified as a cholinesterase-like. It lacks the active site Serine, Histidine


Relationship
Family|Cholinesterase-like
Block| C
Position in NCBI Life Tree|Caligus rogercresseyi
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Crustacea: N E > Maxillopoda: N E > Copepoda: N E > Neocopepoda: N E > Podoplea: N E > Siphonostomatoida: N E > Caligidae: N E > Caligus: N E > Caligus rogercresseyi: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : GAZX01029466
Sequence
Graphical view for this peptide sequence: calro-ACHE1B
Colored MSA for Cholinesterase-like (raw)
MYKWINKVNNIYVLLNLISIVCNAQAIQEDLIVSTDKGKVQGIRQSSVTN
KNVISWLGIPYASPPIGNLRFRHPRPMQPWDGIRNATQPPNSCVQIDDTM
FPGFDGTEKWNANTPISEDCLYLSVTAPEIPKQDKQRLPVLVWIHGGGFF
SGTTTLDVYDPRTLVSEEEILFVGIQYRLGSLGFLFADSHEAPGNAGLFD
QLMALVWVKENIIEFGGDPERITIAGGTAGAASVGFHLLSPLSNTYFSQA
IMQSSSALVPWGLLSKKEASARSKDLAGIARCPIDDLSLMIDCLRGLKAT
QIMYLEWESPRLRIMDIPFVPVLDGIFIPDNPREALHLGGYKKVNILIGT
NEDDGQPDMFYNLPDLFKMSENVSIGDEYFTKAVNELNPYVNEVGRNAII
FEYIDWSRPRSPILNRDALTEMMSDHQFTCPTIDFAHGLTGGENKVFMYK
FNHRSSRNPWPVWSGVIQGEEIPFVFGDPLNRSKSYMESEIELSKRMMRY
WSNFVRAGDPNLSLVATETRWPEYNPIQRRVLELQAGNNSISEGLDLRKC
EFWSRYLPNLLSSTTKSLVNNVSLSLEENLEPSKNKGLWNFFTGELFF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYKWINKVNNIYVLLNLISIVCNAQAIQEDLIVSTDKGKVQGIRQSSVTN
KNVISWLGIPYASPPIGNLRFRHPRPMQPWDGIRNATQPPNSCVQIDDTM
FPGFDGTEKWNANTPISEDCLYLSVTAPEIPKQDKQRLPVLVWIHGGGFF
SGTTTLDVYDPRTLVSEEEILFVGIQYRLGSLGFLFADSHEAPGNAGLFD
QLMALVWVKENIIEFGGDPERITIAGGTAGAASVGFHLLSPLSNTYFSQA
IMQSSSALVPWGLLSKKEASARSKDLAGIARCPIDDLSLMIDCLRGLKAT
QIMYLEWESPRLRIMDIPFVPVLDGIFIPDNPREALHLGGYKKVNILIGT
NEDDGQPDMFYNLPDLFKMSENVSIGDEYFTKAVNELNPYVNEVGRNAII
FEYIDWSRPRSPILNRDALTEMMSDHQFTCPTIDFAHGLTGGENKVFMYK
FNHRSSRNPWPVWSGVIQGEEIPFVFGDPLNRSKSYMESEIELSKRMMRY
WSNFVRAGDPNLSLVATETRWPEYNPIQRRVLELQAGNNSISEGLDLRKC
EFWSRYLPNLLSSTTKSLVNNVSLSLEENLEPSKNKGLWNFFTGELFF


Reference
    Title: Caligus rogercresseyi acetylcholinesterase types and variants: a potential marker for organophosphate resistance
    Agusti-Ridaura C, Dondrup M, Horsberg TE, Leong JS, Koop BF, Bravo S, Mendoza J, Kaur K
    Ref: Parasit Vectors, 11:570, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer