Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: camfo-e1zyd7

Camponotus floridanus (Florida carpenter ant); Lasius niger (Black garden ant). Pancreatic triacylglycerol lipase

Comment
Other strains: Camponotus floridanus (Florida carpenter ant); Lasius niger (Black garden ant)


Relationship
Family|Pancreatic_lipase
Block| L
Position in NCBI Life Tree|Camponotus floridanus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Hymenoptera: N E > Apocrita: N E > Aculeata: N E > Vespoidea: N E > Formicidae: N E > Formicinae: N E > Camponotini: N E > Camponotus: N E > Camponotus floridanus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : GL435204, LBMM01014685
2 UniProt : E1ZYD7, A0A0J7K4J3
2 UniProt : E1ZYD7, A0A0J7K4J3
2 Interpro : E1ZYD7, A0A0J7K4J3
2 Pfam : E1ZYD7, A0A0J7K4J3
2 PIRSF : E1ZYD7, A0A0J7K4J3
2 SUPERFAM : E1ZYD7, A0A0J7K4J3
Sequence
Graphical view for this peptide sequence: camfo-e1zyd7
Colored MSA for Pancreatic_lipase (raw)
MTPSILRRMRRSGMNGRGVGGNDKGALVLLLVAFTPVICSAGILDPWQWA
RSDRIEVNIPWLPFENETRCYEELGCLNITRSWYHLIHRPLNVFPLPRDV
INTRFILYTNKNPLDAIENCEKLNNLVRFFQGQILKVAKDKSIENSNFNS
KRKTKFIIHGFIDTPLSNWVKEMRSELLVHGDYNVIVVDWAGGSLPLYTQ
ATANTRLVGLELAHLIKHLQTNYGMNPDDVHLIGHSLGAHTAGYAGEKLS
GNIGRITGLDPAEPYFQGMPNHLRLDPSDARLVDVIHTDGKSIFFLGYGM
SQPCGHLDFYPNNGKEQPGCTDLSETTPSLPLTLIREGLEEASRVLVACN
HVRALKLFIESINSKCQYVAHECSSYASFLRGECFSCKSNNSLSCGVMGY
HADTSPALVKRQAMGQDVSSLLGSKFFFMTGKEDPYCRRHYRITVNLARP
PTAESWVQGFMKVTVHADNGVIRNMDLTPRFFFQQNTLTMLFISFSGYMK
LEHGTTTRIVVAHPTGSIGNIGKVRRVELSWVYDMDVLQPRSLCFFWCND
RLYVNSVSVDAMDLPGRGKREVDFSSKLCSTGRQEYAEIASGSTATFVDN
C
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTPSILRRMRRSGMNGRGVGGNDKGALVLLLVAFTPVICSAGILDPWQWA
RSDRIEVNIPWLPFENETRCYEELGCLNITRSWYHLIHRPLNVFPLPRDV
INTRFILYTNKNPLDAIENCEKLNNLVRFFQGQILKVAKDKSIENSNFNS
KRKTKFIIHGFIDTPLSNWVKEMRSELLVHGDYNVIVVDWAGGSLPLYTQ
ATANTRLVGLELAHLIKHLQTNYGMNPDDVHLIGHSLGAHTAGYAGEKLS
GNIGRITGLDPAEPYFQGMPNHLRLDPSDARLVDVIHTDGKSIFFLGYGM
SQPCGHLDFYPNNGKEQPGCTDLSETTPSLPLTLIREGLEEASRVLVACN
HVRALKLFIESINSKCQYVAHECSSYASFLRGECFSCKSNNSLSCGVMGY
HADTSPALVKRQAMGQDVSSLLGSKFFFMTGKEDPYCRRHYRITVNLARP
PTAESWVQGFMKVTVHADNGVIRNMDLTPRFFFQQNTLTMLFISFSGYMK
LEHGTTTRIVVAHPTGSIGNIGKVRRVELSWVYDMDVLQPRSLCFFWCND
RLYVNSVSVDAMDLPGRGKREVDFSSKLCSTGRQEYAEIASGSTATFVDN
C


Reference
    Title: Genomic comparison of the ants Camponotus floridanus and Harpegnathos saltator
    Bonasio R, Zhang G, Ye C, Mutti NS, Fang X, Qin N, Donahue G, Yang P, Li Q and Liebig J <6 more author(s)>
    Ref: Science, 329:1068, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer