Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: canal-q59m48

Candida albicans, Candida dubliniensis, potential alpha-factor pheromone maturation protease

Comment
Other strains; Candida albicans (strains SC5314; WO-1) Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCP 3949 / NRRL Y-17841)


Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Candida albicans SC5314
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Debaryomycetaceae: N E > Candida/Lodderomyces clade: N E > Candida [Debaryomycetaceae]: N E > Candida albicans: N E > Candida albicans SC5314: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AACQ01000236, AACQ01000235, FM992695
3 UniProt : Q59M48, B9WLX7, C4YLZ9
3 UniProt : Q59M48, B9WLX7, C4YLZ9
3 Interpro : Q59M48, B9WLX7, C4YLZ9
3 Pfam : Q59M48, B9WLX7, C4YLZ9
3 PIRSF : Q59M48, B9WLX7, C4YLZ9
3 SUPERFAM : Q59M48, B9WLX7, C4YLZ9
Sequence
Graphical view for this peptide sequence: canal-q59m48
Colored MSA for DPP4N_Peptidase_S9 (raw)
MFTHKRVPQHEEYELVNQVPPTQSPTDSPTRSESDFRNSTDSQLSDIFED
LENYSGSSGQKIEDFNDSPLFQSVLMRYKNEGISGRTCGIFSLVAIFLWI
GSVIIYSRVNHSTIGNDLTWKTNIIQLNGENITLNEYNPNFKNITMNDWR
KGKYHTFEKQIRWLTSKQSPKSKHGGGFYVLDEHDKIVVNQIGQVDKSDT
FLSNKQFEYGNNFFKIQDFILNPSQSIEDSEVVHIIITDTVHQWRHSSFA
LYWLFKPLVGTYTPIQPPRNNNKGNGLEVDALDKLHYADFSSDGKYIVFG
FEHNLFIQDLATGEIQQITDDGSPNIINGKSDWIYEEEVIASNKMIWWSP
SGNHFIFAKINETKVQEVDMDYYTKQNTNIGMQYQQVGESKYEGVNQYPI
NTQLKYPKPGTSNPILSLYIYDIANKKTEEIIDGDDNLGTEYILYYAKWI
DANSFLMKQSDRTSSVLTKKLYDLDKNHVSIVSSSNVTKEYKGWVERMNP
ITLLDDGKYIDNVVIDNRNTLALFDSPHSVSPSKVLVDNKDWDITGEAIY
DAQEKFVYFLSTVRSSMDAHLVGIDLADNYKLYNITDTKKDGIFETKFSE
NGQYLSLVYQGPNQPWQRLINMANVHDFIKSEEYGKSTIEEAVILNQPIV
NSLANLKEINLPTVRYKEVTIGKKEDQVTLNIMEILPPNFKAKNQKYPLF
VYTYGGPGSQTVMKKFDIGFLQIVSARLNSIILVIDPRGTGGKGWKFESF
AKNNIGYWESRDLKTITSEYIKKNKKLIDKERVALWGWSYGGFVTLKTLE
YDKGEVFKYGMAVAPVTNWLFYDSIYTERYMGLPDTDPNYETSARINDFD
NFKSVKRFLLVHGTGDDNVHVQNLMWLLDQLNIHNVENYDMHLFPDSDHS
ISYDNAGVIVYDKLYYWLQNAFRGNFDELN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFTHKRVPQHEEYELVNQVPPTQSPTDSPTRSESDFRNSTDSQLSDIFED
LENYSGSSGQKIEDFNDSPLFQSVLMRYKNEGISGRTCGIFSLVAIFLWI
GSVIIYSRVNHSTIGNDLTWKTNIIQLNGENITLNEYNPNFKNITMNDWR
KGKYHTFEKQIRWLTSKQSPKSKHGGGFYVLDEHDKIVVNQIGQVDKSDT
FLSNKQFEYGNNFFKIQDFILNPSQSIEDSEVVHIIITDTVHQWRHSSFA
LYWLFKPLVGTYTPIQPPRNNNKGNGLEVDALDKLHYADFSSDGKYIVFG
FEHNLFIQDLATGEIQQITDDGSPNIINGKSDWIYEEEVIASNKMIWWSP
SGNHFIFAKINETKVQEVDMDYYTKQNTNIGMQYQQVGESKYEGVNQYPI
NTQLKYPKPGTSNPILSLYIYDIANKKTEEIIDGDDNLGTEYILYYAKWI
DANSFLMKQSDRTSSVLTKKLYDLDKNHVSIVSSSNVTKEYKGWVERMNP
ITLLDDGKYIDNVVIDNRNTLALFDSPHSVSPSKVLVDNKDWDITGEAIY
DAQEKFVYFLSTVRSSMDAHLVGIDLADNYKLYNITDTKKDGIFETKFSE
NGQYLSLVYQGPNQPWQRLINMANVHDFIKSEEYGKSTIEEAVILNQPIV
NSLANLKEINLPTVRYKEVTIGKKEDQVTLNIMEILPPNFKAKNQKYPLF
VYTYGGPGSQTVMKKFDIGFLQIVSARLNSIILVIDPRGTGGKGWKFESF
AKNNIGYWESRDLKTITSEYIKKNKKLIDKERVALWGWSYGGFVTLKTLE
YDKGEVFKYGMAVAPVTNWLFYDSIYTERYMGLPDTDPNYETSARINDFD
NFKSVKRFLLVHGTGDDNVHVQNLMWLLDQLNIHNVENYDMHLFPDSDHS
ISYDNAGVIVYDKLYYWLQNAFRGNFDELN


References
    Title: Evolution of pathogenicity and sexual reproduction in eight Candida genomes
    Butler G, Rasmussen MD, Lin MF, Santos MA, Sakthikumar S, Munro CA, Rheinbay E, Grabherr M, Forche A and Cuomo CA <41 more author(s)>
    Ref: Nature, 459:657, 2009 : PubMed

            

    Title: Comparative genomics of the fungal pathogens Candida dubliniensis and Candida albicans
    Jackson AP, Gamble JA, Yeomans T, Moran GP, Saunders D, Harris D, Aslett M, Barrell JF, Butler G and Berriman M <16 more author(s)>
    Ref: Genome Res, 19:2231, 2009 : PubMed

            

    Title: The diploid genome sequence of Candida albicans
    Jones T, Federspiel NA, Chibana H, Dungan J, Kalman S, Magee BB, Newport G, Thorstenson YR, Agabian N and Scherer S <2 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:7329, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer