Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: canal-q59nx8

Candida albicans (Yeast) Potential esterase/lipase

Comment
Other strains: Candida albicans SC5314 P57072 Ca529L P57055 P76067; WO-1


Relationship
Family|Steryl_acetyl_hydrolase
Block| H
Position in NCBI Life Tree|Candida albicans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Debaryomycetaceae: N E > Candida/Lodderomyces clade: N E > Candida [Debaryomycetaceae]: N E > Candida albicans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 4 more: KAF6059873, XP_711430, KGR05800
2 UniProt : A0A1D8PNQ4, C4YRN6
2 Interpro : A0A1D8PNQ4, C4YRN6
2 Prodom : A0A1D8PNQ4, C4YRN6
2 Pfam : A0A1D8PNQ4, C4YRN6
2 PIRSF : A0A1D8PNQ4, C4YRN6
2 SUPERFAM : A0A1D8PNQ4, C4YRN6
Sequence
Graphical view for this peptide sequence: canal-q59nx8
Colored MSA for Steryl_acetyl_hydrolase (raw)
MISIQGLVILLSIPIKLLIVLLKYPFVGGINPKFRNSLIGSFKMTIYKTA
LTIPVRDSGLFSIMSNYFIINKLIKTLYPTLTSLPNYGKKYDKQSYWLVE
SKDRKPSDPVLIFLHGGGYFVQTMPSQIESLLSIYHLLEEPQKSKLSILV
LDYKLACHGYKVPYQLTELIDTYTNLVKDGSKNILLMGDSAGGNLALIFL
QSLKIDKLSLPYPSSVLLISPWVKLAPDNFQNTPGNSYYDNAAHDMLPFN
SHSSELLESLLGDSRVYSLTISPGNCPYNETDWKDIPSLNHPGYSVFVIT
GEHECFRDDILEWANHSLQSPLTPQKGDSQGRFNPKIHQYIRDTPDTAYA
EVLIEPCGVHDSVLYFENSIISILKNNPRLNAKSLDKVEYFGITKVVDFL
NKTLSSEEKKGVKPLL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MISIQGLVILLSIPIKLLIVLLKYPFVGGINPKFRNSLIGSFKMTIYKTA
LTIPVRDSGLFSIMSNYFIINKLIKTLYPTLTSLPNYGKKYDKQSYWLVE
SKDRKPSDPVLIFLHGGGYFVQTMPSQIESLLSIYHLLEEPQKSKLSILV
LDYKLACHGYKVPYQLTELIDTYTNLVKDGSKNILLMGDSAGGNLALIFL
QSLKIDKLSLPYPSSVLLISPWVKLAPDNFQNTPGNSYYDNAAHDMLPFN
SHSSELLESLLGDSRVYSLTISPGNCPYNETDWKDIPSLNHPGYSVFVIT
GEHECFRDDILEWANHSLQSPLTPQKGDSQGRFNPKIHQYIRDTPDTAYA
EVLIEPCGVHDSVLYFENSIISILKNNPRLNAKSLDKVEYFGITKVVDFL
NKTLSSEEKKGVKPLL


Reference
    Title: The diploid genome sequence of Candida albicans
    Jones T, Federspiel NA, Chibana H, Dungan J, Kalman S, Magee BB, Newport G, Thorstenson YR, Agabian N and Scherer S <2 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:7329, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer