canfa-1plip

 
Canis familiaris Inactive pancreatic lipase-related protein 1

Relationship
Block L
Canis lupus familiaris position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Carnivora: N E > Caniformia: N E > Canidae: N E > Canis: N E > Canis lupus: N E > Canis lupus familiaris: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
1RP1: Dog pancreatic lipase-related protein 1
No kinetic



>3 Genbank links 10 more: M35302, M28151, M28141
1 UniProt : P06857
1 Ncbi-nid : 164047
1 Ncbi-pid : 164048
1 Structure : 1RP1
1 UniProtTrembl : P06857
1 Interpro : P06857
1 Prodom : P06857
1 Pfam : P06857
1 PIRSF : P06857
1 SUPERFAM : P06857
1 QuickSwissBlast : P06857
 
Sequence
Graphical view for this peptide sequence: canfa-1plip
Colored MSA for Pancreatic_lipase (raw)
MVSIWTIALFLLGAAKAKEVCYEQIGCFSDAEPWAGTAIRPLKVLPWSPE
RIGTRFLLYTNKNPNNFQTLLPSDPSTIEASNFQTDKKTRFIIHGFIDKG
EENWLLDMCKNMFKVEEVNCICVDWKKGSQTSYTQAANNVRVVGAQVAQM
LSMLSANYSYSPSQVQLIGHSLGAHVAGEAGSRTPGLGRITGLDPVEASF
QGTPEEVRLDPTDADFVDVIHTDAAPLIPFLGFGTSQQMGHLDFFPNGGE
EMPGCKKNALSQIVDLDGIWEGTRDFVACNHLRSYKYYSESILNPDGFAS
YPCASYRAFESNKCFPCPDQGCPQMGHYADKFAVKTSDETQKYFLNTGDS
SNFARWRYGVSITLSGKRATGQAKVALFGSKGNTHQFNIFKGILKPGSTH
SNEFDAKLDVGTIEKVKFLWNNNVVNPTFPKVGAAKITVQKGEEKTVHSF
CSESTVREDVLLTLTPC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVSIWTIALFLLGAAKAKEVCYEQIGCFSDAEPWAGTAIRPLKVLPWSPE
RIGTRFLLYTNKNPNNFQTLLPSDPSTIEASNFQTDKKTRFIIHGFIDKG
EENWLLDMCKNMFKVEEVNCICVDWKKGSQTSYTQAANNVRVVGAQVAQM
LSMLSANYSYSPSQVQLIGHSLGAHVAGEAGSRTPGLGRITGLDPVEASF
QGTPEEVRLDPTDADFVDVIHTDAAPLIPFLGFGTSQQMGHLDFFPNGGE
EMPGCKKNALSQIVDLDGIWEGTRDFVACNHLRSYKYYSESILNPDGFAS
YPCASYRAFESNKCFPCPDQGCPQMGHYADKFAVKTSDETQKYFLNTGDS
SNFARWRYGVSITLSGKRATGQAKVALFGSKGNTHQFNIFKGILKPGSTH
SNEFDAKLDVGTIEKVKFLWNNNVVNPTFPKVGAAKITVQKGEEKTVHSF
CSESTVREDVLLTLTPC

Graphical view for this nucleotide DNA sequence (1536 bp): canfa-1plip



References
1 more
    Title: Pancreatic lipase-related protein 1 (PLRP1) is present in the pancreatic juice of several species
    De Caro J, Carriere F, Barboni P, Giller T, Verger R, de Caro A
    Ref: Biochimica & Biophysica Acta, 1387:331, 1998 : PubMed

            

    Title: Structure of the canine pancreatic lipase gene
    Mickel FS, Weidenbach F, Swarovsky B, LaForge KS, Scheele GA
    Ref: Journal of Biological Chemistry, 264:12895, 1989 : PubMed

            

    Title: Primary structures of canine pancreatic lipase and phospholipase A2 messenger RNAs
    Kerfelec B, LaForge KS, Puigserver A, Scheele G
    Ref: Pancreas, 1:430, 1986 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer