Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: canru-4lipa

Candida rugosa (Diutina rugosa) (Yeast) triacylglycerol lipase 4 precursor

Comment
Other strains Candida sp. AC-IITM


Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Candida rugosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetales incertae sedis: N E > Diutina: N E > Diutina rugosa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 4 more: X66007, JN033801, JN033802
>3 UniProt links 4 more: P32948, G8FRI9, G8FRJ0
1 Ncbi-nid : 296935
>3 UniProt links 4 more: P32948, G8FRI9, G8FRJ0
>3 Interpro links 4 more: P32948, G8FRI9, G8FRJ0
>3 Prodom links 4 more: P32948, G8FRI9, G8FRJ0
>3 Pfam links 4 more: P32948, G8FRI9, G8FRJ0
>3 PIRSF links 4 more: P32948, G8FRI9, G8FRJ0
>3 SUPERFAM links 4 more: P32948, G8FRI9, G8FRJ0
Sequence
Graphical view for this peptide sequence: canru-4lipa
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MKLALVLSLIVSVAAAPTATLANGDTITGLNAIINEAFLGIPFAQPPVGN
LRFKPPVPYSASLNGQKFTSYGPSCMQMNPLGNWDSSLPKAAINSLMQSK
LFQAVLPNGEDCLTINVVRPSGTKPGANLPVMVWIFGGGFEVGGSSLFPP
AQMITASVLMGKPIIHVSMNYRVASWGFLAGPDIKAEGSGNAGLHDQRLG
LQWVADNIAGFGGDPSKVTIFGESAGSMSVMCQLLWNDGDNTYNGKPLFR
AAIMQSGAMVPSDPVDGPYGTQIYDQVVASAGCGSASDKLACLRSISNDK
LFQATSDTPGALAYPSLRLSFLPRPDGTFITDDMFKLVRDGKCANVPVII
GDQNDEGTVFALSSLNVTTDAQARQYFKESFIHASDAEIDTLMAAYPSDI
TQGSPFDTGIFNAITPQFKRIAAVLGDLAFTLPRRYFLNHFQGGTKYSFL
SKQLSGLPVIGTHHANDIVWQDFLVSHSSAVYNNAFIAFANDLDPNKAGL
LVNWPKYTSSSQSGNNLLQINALGLYTGKDNFRTAGYDALFTNPSSFFV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKLALVLSLIVSVAAAPTATLANGDTITGLNAIINEAFLGIPFAQPPVGN
LRFKPPVPYSASLNGQKFTSYGPSCMQMNPLGNWDSSLPKAAINSLMQSK
LFQAVLPNGEDCLTINVVRPSGTKPGANLPVMVWIFGGGFEVGGSSLFPP
AQMITASVLMGKPIIHVSMNYRVASWGFLAGPDIKAEGSGNAGLHDQRLG
LQWVADNIAGFGGDPSKVTIFGESAGSMSVMCQLLWNDGDNTYNGKPLFR
AAIMQSGAMVPSDPVDGPYGTQIYDQVVASAGCGSASDKLACLRSISNDK
LFQATSDTPGALAYPSLRLSFLPRPDGTFITDDMFKLVRDGKCANVPVII
GDQNDEGTVFALSSLNVTTDAQARQYFKESFIHASDAEIDTLMAAYPSDI
TQGSPFDTGIFNAITPQFKRIAAVLGDLAFTLPRRYFLNHFQGGTKYSFL
SKQLSGLPVIGTHHANDIVWQDFLVSHSSAVYNNAFIAFANDLDPNKAGL
LVNWPKYTSSSQSGNNLLQINALGLYTGKDNFRTAGYDALFTNPSSFFV


Reference
    Title: Cloning and analysis of Candida cylindracea lipase sequences
    Lotti Marina, Grandori R, Fusetti F, Longhi S, Brocca S, Tramontano A, Alberghina L, Lotti M
    Ref: Gene, 124:45, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer