Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cantt-c5mag0

Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast) Lipase 4, CtroL4

Relationship
Family|Fungal-Bact_LIP
Block| X
Position in NCBI Life Tree|Candida tropicalis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Debaryomycetaceae: N E > Candida/Lodderomyces clade: N E > Candida [Debaryomycetaceae]: N E > Candida tropicalis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : GG692398, XP_002548755
1 UniProt : C5MAG0
1 UniProt : C5MAG0
1 Interpro : C5MAG0
1 Prodom : C5MAG0
1 Pfam : C5MAG0
1 PIRSF : C5MAG0
1 SUPERFAM : C5MAG0
Sequence
Graphical view for this peptide sequence: cantt-c5mag0
Colored MSA for Fungal-Bact_LIP (raw)
MKIIYLILAFITSTYCGILFPAKPSNDLFYNAPAGYENAKVGDILQHRST
PKPITGAFFPSKVQNSWQLLVRSEDSFGNPNVLVTTVLQPFNADSSKVVS
YQAYEDSAKFDCAPSYAIQYGSDISTFATQAEMPFISVLIDQGYYVVVPD
YEGPKSTFTVGRQSGQATLNSIRAALKSGNLTSIDENAKVVMWGYSGGSL
ASGWAAALQPKYAPELNNNLIGVALGGFVTNITATAEATDGTVFAGIVAN
ALGGISNEYSLLKSTLAADANILLKFKINQFDDFCLFDSILNFVGTQFFV
GVARIFKSGWSILDKPGIRDIVEGNGLVYFTEIPKIPAFIYHGTVDQIVP
IVNAKKTYQNWCDAGISSLEFAEDASNGHLTETIVGAPAALTWIMARLSG
NAPVSGCQHTKRQSNFDYPNIPPAILEYFQSGLKTVIGAGLGPDIQKDQV
SAIGLTKISTFLK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKIIYLILAFITSTYCGILFPAKPSNDLFYNAPAGYENAKVGDILQHRST
PKPITGAFFPSKVQNSWQLLVRSEDSFGNPNVLVTTVLQPFNADSSKVVS
YQAYEDSAKFDCAPSYAIQYGSDISTFATQAEMPFISVLIDQGYYVVVPD
YEGPKSTFTVGRQSGQATLNSIRAALKSGNLTSIDENAKVVMWGYSGGSL
ASGWAAALQPKYAPELNNNLIGVALGGFVTNITATAEATDGTVFAGIVAN
ALGGISNEYSLLKSTLAADANILLKFKINQFDDFCLFDSILNFVGTQFFV
GVARIFKSGWSILDKPGIRDIVEGNGLVYFTEIPKIPAFIYHGTVDQIVP
IVNAKKTYQNWCDAGISSLEFAEDASNGHLTETIVGAPAALTWIMARLSG
NAPVSGCQHTKRQSNFDYPNIPPAILEYFQSGLKTVIGAGLGPDIQKDQV
SAIGLTKISTFLK


References
1 more
    Title: A glimpse into the specialization history of the lipases/acyltransferases family of CpLIP2
    Jan AH, Dubreucq E, Drone J, Subileau M
    Ref: Biochimica & Biophysica Acta, 1865:1105, 2017 : PubMed

            

    Title: Peculiar features of four enzymes of the CaLA superfamily in aqueous media: Differences in substrate specificities and abilities to catalyze alcoholysis
    Neang PM, Subileau M, Perrier V, Dubreucq E
    Ref: J Mol Catal B Enzym, 94:36, 2013 : PubMed

            

    Title: Evolution of pathogenicity and sexual reproduction in eight Candida genomes
    Butler G, Rasmussen MD, Lin MF, Santos MA, Sakthikumar S, Munro CA, Rheinbay E, Grabherr M, Forche A and Cuomo CA <41 more author(s)>
    Ref: Nature, 459:657, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer