Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: capan-a5yw95

Capsicum annuum (Capsicum pepper) phospholipase A1, CaPLA1

Relationship
Family|Plant_phospholipase
Block| L
Position in NCBI Life Tree|Capsicum annuum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Solanales: N E > Solanaceae: N E > Solanoideae: N E > Capsiceae: N E > Capsicum: N E > Capsicum annuum: N E


Molecular evidence
Database
No mutation
1 structure:
7X0D: Crystal Structure of Capsicum annuum (Capsicum pepper) phospholipase A1, CaPLA1
No kinetic





No Substrate
No inhibitor
3 Genbank : ABQ95989, PHT95717, NP_001311733
1 UniProt : A5YW95
1 Structure : 7X0D
1 UniProt : A5YW95
1 Interpro : A5YW95
1 Pfam : A5YW95
1 PIRSF : A5YW95
1 SUPERFAM : A5YW95
Sequence
Graphical view for this peptide sequence: capan-a5yw95
Colored MSA for Plant_phospholipase (raw)
MGSMAEKWEELSGKNNWEGLLNPLDLDLRKYIIQYGELAQATYDTFISER
ASKYAGASRYSMENFFTKVGLDPSKYHVTKFFYGTSSIPLPDAFMTRSLS
REAWSKESNFMGYIAVATDEGKVALGRRDIVINWRGTLQVLEWVNDLQFL
LVPAPKVFGDGGLLPLFHPLVHHGFHNIYTTENPRSQFNKTCVRDQVMEE
VKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGINKSSNGKEFPV
TAFVFASPKVGDLNFHKAFSKLKHLHILRIHNLLDIVPKYPPVGYFDVGQ
ELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGIGMTAGFKLEVNRD
ISLVNKQWMILKDEYCIPPLWWSEKHKGMVQQQDGSWLLQDRDDYEF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGSMAEKWEELSGKNNWEGLLNPLDLDLRKYIIQYGELAQATYDTFISER
ASKYAGASRYSMENFFTKVGLDPSKYHVTKFFYGTSSIPLPDAFMTRSLS
REAWSKESNFMGYIAVATDEGKVALGRRDIVINWRGTLQVLEWVNDLQFL
LVPAPKVFGDGGLLPLFHPLVHHGFHNIYTTENPRSQFNKTCVRDQVMEE
VKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGINKSSNGKEFPV
TAFVFASPKVGDLNFHKAFSKLKHLHILRIHNLLDIVPKYPPVGYFDVGQ
ELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGIGMTAGFKLEVNRD
ISLVNKQWMILKDEYCIPPLWWSEKHKGMVQQQDGSWLLQDRDDYEF


Reference
    Title: Crystal Structures of the Plant Phospholipase A1 Proteins Reveal a Unique Dimerization Domain
    Heo Y, Lee I, Moon S, Yun JH, Kim EY, Park SY, Park JH, Kim WT, Lee W
    Ref: Molecules, 27:, 2022 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer