Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: capod-c7m590

Capnocytophaga ochracea (strain ATCC 27872 / DSM 7271 / JCM 12966 VPI 2845) (Bacteroides ochraceus) Putative uncharacterized protein

Comment
no active S


Relationship
Family|A85-IroE-IroD-Fes-Yiel
Block| X
Position in NCBI Life Tree|Capnocytophaga ochracea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Flavobacteriia: N E > Flavobacteriales: N E > Flavobacteriaceae: N E > Capnocytophaga: N E > Capnocytophaga ochracea: N E


Molecular evidence
Database
No mutation
1 structure:
4W9R: Crystal structure of uncharacterised protein Coch_1243 from Capnocytophaga ochracea DSM 7271
No kinetic





No Substrate
No inhibitor
1 Genbank : CP001632
1 UniProt : C7M590
1 Structure : 4W9R
1 UniProt : C7M590
1 Interpro : C7M590
1 Prodom : C7M590
1 Pfam : C7M590
1 PIRSF : C7M590
1 SUPERFAM : C7M590
Sequence
Graphical view for this peptide sequence: capod-c7m590
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MKKYLTIVIALVTLQSAFSQVISETFSSGRLNRKQKIGIYKPEKYTDRQA
YPLIVVLNAETLMEPVVSMVRYYEQFGEMPKCIVVGVYEPKQEDVTVVEE
VGRPINESARFFEFVSAELVPYIQGKYPIADLKGVIASEEAGFLANYYML
AEKKPTFNMIVSLNPVALPRMGEEFSHALAAGVPNRLFYYMATADVENKV
VYDKAIQFERAMRSAPVHESVEYHFVDFKGSSVNAAKLQGIAQALDMCFD
IYKPIGGKEFKTQMETLETGIYEYLENKYNTIYKQLGVKKVPILNDVMAT
YTAINSSQDWESLKKLAKYVESNGYLKTAMPNFFLAEYYEKIGDDKKALK
TYQKAYTEPNIDFITGDLINERITHLQATKRKSKHTKVIEPIEPTEEVAP
AQEEQNPTDESNQN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKYLTIVIALVTLQSAFSQVISETFSSGRLNRKQKIGIYKPEKYTDRQA
YPLIVVLNAETLMEPVVSMVRYYEQFGEMPKCIVVGVYEPKQEDVTVVEE
VGRPINESARFFEFVSAELVPYIQGKYPIADLKGVIASEEAGFLANYYML
AEKKPTFNMIVSLNPVALPRMGEEFSHALAAGVPNRLFYYMATADVENKV
VYDKAIQFERAMRSAPVHESVEYHFVDFKGSSVNAAKLQGIAQALDMCFD
IYKPIGGKEFKTQMETLETGIYEYLENKYNTIYKQLGVKKVPILNDVMAT
YTAINSSQDWESLKKLAKYVESNGYLKTAMPNFFLAEYYEKIGDDKKALK
TYQKAYTEPNIDFITGDLINERITHLQATKRKSKHTKVIEPIEPTEEVAP
AQEEQNPTDESNQN


Reference
    Title: Complete genome sequence of Capnocytophaga ochracea type strain (VPI 2845)
    Mavrommatis K, Gronow S, Saunders E, Land M, Lapidus A, Copeland A, Glavina Del Rio T, Nolan M, Lucas S and Hugenholtz P <24 more author(s)>
    Ref: Stand Genomic Sci, 1:101, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer