Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: castro-CS

Catharanthus roseus (Madagascar periwinkle) hydrolase 1, 2-hydroxyisoflavanone dehydratase Tabersonine Synthase TS

Comment
Component of iboga and aspidosperma monoterpenoid indole alkaloids (MIAs, e.g. tabersonine and catharanthine) biosynthesis pathway from 19E-geissoschizine. Catalyzes the conversion of O-acetylstemmadenine (OAS) to catharanthine.


Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Catharanthus roseus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Gentianales: N E > Apocynaceae: N E > Rauvolfioideae: N E > Vinceae: N E > Catharanthinae: N E > Catharanthus: N E > Catharanthus roseus: N E


Molecular evidence
Database
No mutation
1 structure:
6RT8: Structure of catharanthine synthase - an alpha-beta hydrolase from Catharanthus roseus with a cleaviminium intermediate bound
No kinetic





No Substrate
1 inhbitor:
18-carboxymethoxy-cleaviminium
2 Genbank : AVM85920, MF770512
1 Structure : 6RT8
1 UniProt : A0A2P1GIW2
1 Interpro : A0A2P1GIW2
1 Prodom : A0A2P1GIW2
1 Pfam : A0A2P1GIW2
1 PIRSF : A0A2P1GIW2
1 SUPERFAM : A0A2P1GIW2
Sequence
Graphical view for this peptide sequence: castro-CS
Colored MSA for Plant_carboxylesterase (raw)
MNSSTDPTSDETIWDLSPYIKIFKDGRVERLHNSPYVPPSLNDPETGVSW
KDVPISSQVSARVYIPKISDHEKLPIFVYVHGAGFCLESAFRSFFHTFVK
HFVAETKVIGVSIEYRLAPEHLLPAAYEDCWEALQWVASHVGLDNSGLKT
AIDKDPWIINYGDFDRLYLAGDSPGANIVHNTLIRAGKEKLKGGVKILGA
ILYYPYFIIPTSTKLSDDFEYNYTCYWKLAYPNAPGGMNNPMINPIAENA
PDLAGYGCSRLLVTLVSMISTTPDETKDINAVYIEALEKSGWKGELEVAD
FDADYFELFTLETEMGKNMFRRLASFIKHE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNSSTDPTSDETIWDLSPYIKIFKDGRVERLHNSPYVPPSLNDPETGVSW
KDVPISSQVSARVYIPKISDHEKLPIFVYVHGAGFCLESAFRSFFHTFVK
HFVAETKVIGVSIEYRLAPEHLLPAAYEDCWEALQWVASHVGLDNSGLKT
AIDKDPWIINYGDFDRLYLAGDSPGANIVHNTLIRAGKEKLKGGVKILGA
ILYYPYFIIPTSTKLSDDFEYNYTCYWKLAYPNAPGGMNNPMINPIAENA
PDLAGYGCSRLLVTLVSMISTTPDETKDINAVYIEALEKSGWKGELEVAD
FDADYFELFTLETEMGKNMFRRLASFIKHE


References
    Title: Structural basis of cycloaddition in biosynthesis of iboga and aspidosperma alkaloids
    Caputi L, Franke J, Bussey K, Farrow SC, Vieira IJC, Stevenson CEM, Lawson DM, O'Connor SE
    Ref: Nat Chemical Biology, 16:383, 2020 : PubMed

            

    Title: Missing enzymes in the biosynthesis of the anticancer drug vinblastine in Madagascar periwinkle
    Caputi L, Franke J, Farrow SC, Chung K, Payne RME, Nguyen TD, Dang TT, Soares Teto Carqueijeiro I, Koudounas K and O'Connor SE <5 more author(s)>
    Ref: Science, 360:1235, 2018 : PubMed

            

    Title: Solution of the multistep pathway for assembly of corynanthean, strychnos, iboga, and aspidosperma monoterpenoid indole alkaloids from 19E-geissoschizine
    Qu Y, Easson M, Simionescu R, Hajicek J, Thamm AMK, Salim V, De Luca V
    Ref: Proc Natl Acad Sci U S A, 115:3180, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer