Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: celad-e6xbe7

Cellulophaga algicola (strain DSM 14237 / IC166 / ACAM 630) Alpha/beta hydrolase fold protein

Comment
only n-term Pfam A Abhydrolase_6 28 263 rest Pfam A Methyltransf_20


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Cellulophaga algicola
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Flavobacteriia: N E > Flavobacteriales: N E > Flavobacteriaceae: N E > Cellulophaga: N E > Cellulophaga algicola: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP002453
1 UniProt : E6XBE7
1 UniProt : E6XBE7
1 Interpro : E6XBE7
1 Prodom : E6XBE7
1 Pfam : E6XBE7
1 PIRSF : E6XBE7
1 SUPERFAM : E6XBE7
Sequence
Graphical view for this peptide sequence: celad-e6xbe7
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MSNGHFNSFDGSEIFYRKWNFKPSQKSVIIIHRGHEHSERLNDIATSSQF
SAYNIFAFDLRGHGHTKTETSSVFMDYVRDLDAFSHYLETNYKVNSTDVF
VIANSIGGVVASAWAHDFAPNIAGMALLAPAFRINLIVPLANEMITLGTK
LNKGLIIKSYVKSTMLTHDVAQQKAYDDDSLITRSIDAKLLIDLADAGKR
LVEDAEAIDTPTLILSAEKDKVVFNKDQKIFFDKLDTTLKELEVLPDFFH
GILFETKKEMVYDKMIAFAE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSNGHFNSFDGSEIFYRKWNFKPSQKSVIIIHRGHEHSERLNDIATSSQF
SAYNIFAFDLRGHGHTKTETSSVFMDYVRDLDAFSHYLETNYKVNSTDVF
VIANSIGGVVASAWAHDFAPNIAGMALLAPAFRINLIVPLANEMITLGTK
LNKGLIIKSYVKSTMLTHDVAQQKAYDDDSLITRSIDAKLLIDLADAGKR
LVEDAEAIDTPTLILSAEKDKVVFNKDQKIFFDKLDTTLKELEVLPDFFH
GILFETKKEMVYDKMIAFAE


Reference
    Title: Complete genome sequence of Cellulophaga algicola type strain (IC166)
    Abt B, Lu M, Misra M, Han C, Nolan M, Lucas S, Hammon N, Deshpande S, Cheng JF and Lapidus A <27 more author(s)>
    Ref: Stand Genomic Sci, 4:72, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer