Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cellc-f0rgt2

Cellulophaga lytica (strain ATCC 23178 / DSM 7489 / JCM 8516 / NBRC 14961 / NCIMB 1423 / VKM B-1433 / Cy l20). Secreted lipase/esterase

Relationship
Family|BD-FAE
Block| H
Position in NCBI Life Tree|Cellulophaga lytica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Flavobacteriia: N E > Flavobacteriales: N E > Flavobacteriaceae: N E > Cellulophaga: N E > Cellulophaga lytica: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP002534
1 UniProt : F0RGT2
1 UniProt : F0RGT2
1 Interpro : F0RGT2
1 Prodom : F0RGT2
1 Pfam : F0RGT2
1 PIRSF : F0RGT2
1 SUPERFAM : F0RGT2
Sequence
Graphical view for this peptide sequence: cellc-f0rgt2
Colored MSA for BD-FAE (raw)
MPNYLTFLQRATFLILIVLTTTIGYAQTRYTQKVFSDIKVKTYSYADTLK
LDFYSYKKDTVTNKPLLILVHGGGFSGGKRNNPLEIKFCEDMAKRGYAVA
SMSYRLVRKGNSLGFGCNCPADQKIETFVSVSRDIIKATQFLIDKKGKLK
FNPESIILVGSSAGAEAVLNTVFMKNEYTFKKLPYATIKYAGVISFAGAI
VNANYITKNTAIPTMLFHGAKDNMVPYATAPHHLCEENKPGFIMLDGSYT
IAEKLEKLDVAHTLVSDKDGNHNWANIPYSYTNLIAKFITESVLEKQNIQ
STIKVKHKN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPNYLTFLQRATFLILIVLTTTIGYAQTRYTQKVFSDIKVKTYSYADTLK
LDFYSYKKDTVTNKPLLILVHGGGFSGGKRNNPLEIKFCEDMAKRGYAVA
SMSYRLVRKGNSLGFGCNCPADQKIETFVSVSRDIIKATQFLIDKKGKLK
FNPESIILVGSSAGAEAVLNTVFMKNEYTFKKLPYATIKYAGVISFAGAI
VNANYITKNTAIPTMLFHGAKDNMVPYATAPHHLCEENKPGFIMLDGSYT
IAEKLEKLDVAHTLVSDKDGNHNWANIPYSYTNLIAKFITESVLEKQNIQ
STIKVKHKN


Reference
    Title: Complete genome sequence of Cellulophaga lytica type strain (LIM-21)
    Pati A, Abt B, Teshima H, Nolan M, Lapidus A, Lucas S, Hammon N, Deshpande S, Cheng JF and Ivanova N <26 more author(s)>
    Ref: Stand Genomic Sci, 4:221, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer