Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cepac-cefg

Cephalosporium acremonium (Acremonium chrysogenum) (EC 2.3.1.-) (dcpc-atf) acetylcoa:deacetylcephalosporin c acetyl transferase

Relationship
Family|Homoserine_transacetylase
Block| X
Position in NCBI Life Tree|Cephalosporium acremonium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Hypocreales incertae sedis: N E > Acremonium [Hypocreaceae]: N E > Acremonium chrysogenum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
3 structures: 2VAT, 2VAV, 2VAX
No kinetic





3 substrates: Acetyl-CoA, Cephalosporin-C, Deacetylcephalosporin-C
No inhibitor
>3 Genbank links 2 more: S83551, M91649, X65583
2 UniProt : P39058, Q7LLJ3
3 Structure : 2VAT, 2VAV, 2VAX
2 UniProt : Q7LLJ3, P39058
2 Interpro : Q7LLJ3, P39058
2 Prodom : Q7LLJ3, P39058
2 Pfam : Q7LLJ3, P39058
2 PIRSF : Q7LLJ3, P39058
2 SUPERFAM : Q7LLJ3, P39058
Sequence
Graphical view for this peptide sequence: cepac-cefg
Colored MSA for Homoserine_transacetylase (raw)
MLPSAQVARLKPDPFPPSLSPIPHGAVTFAALAPCHNLPIFSSRQMLRDS
LTYSHTSPTMSPQIANRFEASLDAQDIARISLFTLESGVILRDVPVAYKS
WGRMNVSRDNCVIVCHTLTSSAHVTSWWPTLFGQGRAFDTSRYFIICLNY
LGSPFGSAGPCSPDPDAEGQRPYGAKFPRTTIRDDVRIHRQVLDRLGVRQ
IAAVVGASMGGMHTLEWAFFGPEYVRKIVPIATSCRQSGWCAAWFETQRQ
CIYDDPKYLDGEYDVDDQPVRGLETARKIANLTYKSKPAMDERFHMAPGV
QAGRNISSQDAKKEINGTDSGNSHRAGQPIEAVSSYLRYQAQKFAASFDA
NCYIAMTLKFDTHDISRGRAGSIPEALAMITQPALIICARSDGLYSFDEH
VEMGRSIPNSRLCVVDTNEGHDFFVMEADKVNDAVRGFLDQSLM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLPSAQVARLKPDPFPPSLSPIPHGAVTFAALAPCHNLPIFSSRQMLRDS
LTYSHTSPTMSPQIANRFEASLDAQDIARISLFTLESGVILRDVPVAYKS
WGRMNVSRDNCVIVCHTLTSSAHVTSWWPTLFGQGRAFDTSRYFIICLNY
LGSPFGSAGPCSPDPDAEGQRPYGAKFPRTTIRDDVRIHRQVLDRLGVRQ
IAAVVGASMGGMHTLEWAFFGPEYVRKIVPIATSCRQSGWCAAWFETQRQ
CIYDDPKYLDGEYDVDDQPVRGLETARKIANLTYKSKPAMDERFHMAPGV
QAGRNISSQDAKKEINGTDSGNSHRAGQPIEAVSSYLRYQAQKFAASFDA
NCYIAMTLKFDTHDISRGRAGSIPEALAMITQPALIICARSDGLYSFDEH
VEMGRSIPNSRLCVVDTNEGHDFFVMEADKVNDAVRGFLDQSLM


References
2 more
    Title: Cloning, characterization, and use in strain improvement of the Cephalosporium acremonium gene cefG encoding acetyl transferase
    Mathison L, Soliday C, Stepan T, Aldrich T, Rambosek J
    Ref: Curr Genet, 23:33, 1993 : PubMed

            

    Title: The cefG gene of Cephalosporium acremonium is linked to the cefEF gene and encodes a deacetylcephalosporin C acetyltransferase closely related to homoserine O-acetyltransferase
    Gutierrez S, Velasco J, Fernandez FJ, Martin JF
    Ref: Journal of Bacteriology, 174:3056, 1992 : PubMed

            

    Title: Cloning and disruption of the cefG gene encoding acetyl coenzyme A: deacetylcephalosporin C o-acetyltransferase from Acremonium chrysogenum
    Matsuda A, Sugiura H, Matsuyama K, Matsumoto H, Ichikawa S, Komatsu K
    Ref: Biochemical & Biophysical Research Communications, 186:40, 1992 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer