Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cerca-ACHE

Ceratitis capitata (Mediterranean fruit fly) Acetylcholinesterase

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Ceratitis capitata
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Tephritoidea: N E > Tephritidae: N E > Dacinae: N E > Ceratitidini: N E > Ceratitis [genus]: N E > Ceratitis [subgenus]: N E > Ceratitis capitata: N E


Molecular evidence
Database
1 mutation: cerca-ACHE
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: EU603266, EU130781, FJ480223
3 UniProt : B8PS72, B8Y4I4, B8Y4I5
>3 UniProt links 1 more: B2M121, B8PS72, B8Y4I4
>3 Interpro links 1 more: B2M121, B8PS72, B8Y4I4
>3 Prodom links 1 more: B2M121, B8PS72, B8Y4I4
>3 Pfam links 1 more: B2M121, B8PS72, B8Y4I4
>3 PIRSF links 1 more: B2M121, B8PS72, B8Y4I4
>3 SUPERFAM links 1 more: B2M121, B8PS72, B8Y4I4
Sequence
Graphical view for this peptide sequence: cerca-ACHE
Colored MSA for ACHE (raw)
MARTLALQAPSSLSASSRQHSFASSTSTLRLSSGDIGRGLFAIVILLLRM
SSVYGVIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPLDDLRFR
KPVPAEPWHGVLDATRLPATCVQERYEYFPGFSGEEIWNPNTNVSEDCLY
INVWAPAKARLRHGRGANGGEHSNKADTDHLIHNGNPQNTTNGLPVLIWI
YGGGFMTGTATLDIYNADIMSAVGNVIVASFQYRVGAFGFLHLSPAMPGY
EEEAPGNVGLWDQALAIRWLKTNAHAFGGNPEWMTLFGESAGSSSVNAQL
VSPVTAGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASLLA
ENPQAVMACMRAVDAKTISVQQWNSYSGILSFPSAPTIDGAFLPDDPMKM
METADMRGYDILMGNVRDEGTYFLLYDFIDYFDKDEATSLPRDKYLEIMN
NIFGKVTQAEREAIIFRHTSWVGNPGLENQQQIGRAVGDHFFTCPTNEYA
QVLAERGASVHYYYFTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNTSLQY
RQVERELGKRMLNAVIEFAKTGNPATDGEEWPNFTKKDPVYYVFSTDDKD
EKLQRGPLEGRCAFWNEYLREVRKWGSQCDVKQSSASTIQQNMLQQKIIM
ALLLALSIVLGIPSINAFF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MARTLALQAPSSLSASSRQHSFASSTSTLRLSSGDIGRGLFAIVILLLRM
SSVYGVIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPLDDLRFR
KPVPAEPWHGVLDATRLPATCVQERYEYFPGFSGEEIWNPNTNVSEDCLY
INVWAPAKARLRHGRGANGGEHSNKADTDHLIHNGNPQNTTNGLPVLIWI
YGGGFMTGTATLDIYNADIMSAVGNVIVASFQYRVGAFGFLHLSPAMPGY
EEEAPGNVGLWDQALAIRWLKTNAHAFGGNPEWMTLFGESAGSSSVNAQL
VSPVTAGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASLLA
ENPQAVMACMRAVDAKTISVQQWNSYSGILSFPSAPTIDGAFLPDDPMKM
METADMRGYDILMGNVRDEGTYFLLYDFIDYFDKDEATSLPRDKYLEIMN
NIFGKVTQAEREAIIFRHTSWVGNPGLENQQQIGRAVGDHFFTCPTNEYA
QVLAERGASVHYYYFTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNTSLQY
RQVERELGKRMLNAVIEFAKTGNPATDGEEWPNFTKKDPVYYVFSTDDKD
EKLQRGPLEGRCAFWNEYLREVRKWGSQCDVKQSSASTIQQNMLQQKIIM
ALLLALSIVLGIPSINAFF


Reference
    Title: Mechanisms of resistance to malathion in the medfly Ceratitis capitata
    Magana C, Hernandez-Crespo P, Brun-Barale A, Couso-Ferrer F, Bride JM, Castanera P, Feyereisen R, Ortego F
    Ref: Insect Biochemistry & Molecular Biology, 38:756, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer